The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|451515.3.peg.2020: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
Translate Function Assignments


Context on contig NC_007793 from base 2055082 to 2067249 (12168 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
2014 2055082 2056248 1167 +           Staphopain A precursor (EC 3.4.22.48) locus|SAUSA300_1890, protein_id|YP_494542.1, gi|87160198, geneID|3913266
2015 2056279 2056605 327 + 30         FIG01108472: hypothetical protein  
2016 2057070 2056897 174 - 291         FIG01107984: hypothetical protein locus|SAUSA300_1891, protein_id|YP_494543.1, gi|87160766, geneID|3913741
2017 2057653 2057051 603 - -20         FIG01225759: possible membrane protein locus|SAUSA300_1892, protein_id|YP_494544.1, gi|87161584, geneID|3913653
2018 2058745 2057924 822 - 270     5: 12 7 1 2 8   NAD synthetase (EC 6.3.1.5) gene_name|nadE, locus|SAUSA300_1893, protein_id|YP_494545.1, gi|87162145, geneID|3914692
2019 2060207 2058738 1470 - -8     3: 3 1 2   Nicotinate phosphoribosyltransferase (EC 2.4.2.11) locus|SAUSA300_1894, protein_id|YP_494546.1, gi|87161265, geneID|3915236
2020 2060391 2061467 1077 + 183     1: 13 dlit(12467576) Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47) locus|SAUSA300_1895, protein_id|YP_494547.1, gi|87162121, geneID|3913585
2021 2061487 2062281 795 + 19     5: 5 10 6 4 14   Prephenate dehydratase (EC 4.2.1.51) # ACT domain gene_name|pheA, locus|SAUSA300_1896, protein_id|YP_494548.1, gi|87159909, geneID|3914955
2022 2064033 2062471 1563 - 189         sodium-dependent transporter (huNaDC-1), putative locus|SAUSA300_1897, protein_id|YP_494549.1, gi|87160976, geneID|3913308
2023 2065335 2064238 1098 - 204         cell wall surface anchor family protein locus|SAUSA300_1898, protein_id|YP_494550.1, gi|87160751, geneID|3913414
2024 2065707 2066267 561 + 371     4: 3 1 2 11   Nicotinamidase (EC 3.5.1.19) locus|SAUSA300_1899, protein_id|YP_494551.1, gi|87162153, geneID|3914700
2025 2066320 2067249 930 + 52     2: 9 1   Manganese-dependent inorganic pyrophosphatase (EC 3.6.1.1) gene_name|ppaC, locus|SAUSA300_1900, protein_id|YP_494552.1, gi|87161880, geneID|3914568

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Nitric_oxide_synthase OlgaV Nitric oxide synthase oxygenase (EC 1.-.-.-)


  Protein Sequence

>fig|451515.3.peg.2020 Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSN
RCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNN
QLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIK
EVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDY
RYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFE
RNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH

MD5 = ac47be1f688bb5be235e2132464e02f5


  DNA Sequence

>fig|451515.3.peg.2020 Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
atgttatttaaagaggctcaagctttcatagaaaacatgtataaagagtgtcattatgaa
acgcaaattatcaataaacgtttacatgacattgaactagaaataaaagaaactgggaca
tatacacatacagaagaagaacttatttatggtgctaaaatggcttggcgtaattcaaat
cgttgcattggtcgtttattttgggattcgttaaatgtcattgatgcaagagatgttact
gacgaagcatcgttcttatcatcaattacttatcatattacacaggctacaaatgaaggt
aaattaaagccgtatattactatatatgctccaaaggatggacctaaaattttcaacaat
caattaattcgctatgctggctatgacaattgtggtgatcctgctgaaaaagaagttaca
cgcttagcaaatcacttaggttggaaaggaaaaggtactaattttgacgtgttaccactg
atttaccaattacctaatgagtcagttaaattttacgaatatcctacttcattaattaaa
gaagtacctattgaacataatcattatccaaaattaagaaaattgaacttaaaatggtat
gcagtccctatcatttccaatatggacttaaaaatcggtggcattgtatatccaactgca
ccctttaacggttggtatatggtaactgaaattggcgtacgtaactttattgatgattac
cgttacaatttactagaaaaagttgcagatgcgtttgaatttgatacacttaaaaataat
tcatttaataaagatcgagcacttgttgaattgaactatgctgtgtatcattcctttaaa
aaagaaggcgtatcaattgtcgatcatttgaccgctgcaaagcaattcgaactattcgaa
cgtaacgaagcacaacaaggtcgtcaagttaccggaaaatggtcttggctagcaccgcca
ttatctccaacattgacgtcaaattatcatcacggatatgacaatacagtaaaagatcca
aactttttctataaaaagaaagaatcaaatgctaaccagtgccctttccatcattaa


  DNA with Flanking Sequence

>fig|451515.3.peg.2020 Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
cataattcgccttcttgcatcgaacggatgctgcctgtgaattttaaatcttttaaatat
gataagaaatcatccttgtagccaatagactttaaatattccaaatcagattctgaaaat
ccaaaatgttctataaaatcaatgacgcgttttaaaccattaaaaacagcatagccacta
ttaaatggcatttttctaaaatacaaatcaaatacagccattttttcatgaatattatca
ttccaataactttcagccatatttatttgatataagtcattatgtaacattaaactgtcg
tcttctaattggtacacttgtatctctccaatcgacctaaatattttcttacattttatc
ataattcatttttttatatacataagagccccttaatttccatacttttaattaaaatca
accaacaatttaatgacatatacataatttttaagagtattttaataatgtagactataa
tataaagcgaggtgttgttaatgttatttaaagaggctcaagctttcatagaaaacatgt
ataaagagtgtcattatgaaacgcaaattatcaataaacgtttacatgacattgaactag
aaataaaagaaactgggacatatacacatacagaagaagaacttatttatggtgctaaaa
tggcttggcgtaattcaaatcgttgcattggtcgtttattttgggattcgttaaatgtca
ttgatgcaagagatgttactgacgaagcatcgttcttatcatcaattacttatcatatta
cacaggctacaaatgaaggtaaattaaagccgtatattactatatatgctccaaaggatg
gacctaaaattttcaacaatcaattaattcgctatgctggctatgacaattgtggtgatc
ctgctgaaaaagaagttacacgcttagcaaatcacttaggttggaaaggaaaaggtacta
attttgacgtgttaccactgatttaccaattacctaatgagtcagttaaattttacgaat
atcctacttcattaattaaagaagtacctattgaacataatcattatccaaaattaagaa
aattgaacttaaaatggtatgcagtccctatcatttccaatatggacttaaaaatcggtg
gcattgtatatccaactgcaccctttaacggttggtatatggtaactgaaattggcgtac
gtaactttattgatgattaccgttacaatttactagaaaaagttgcagatgcgtttgaat
ttgatacacttaaaaataattcatttaataaagatcgagcacttgttgaattgaactatg
ctgtgtatcattcctttaaaaaagaaggcgtatcaattgtcgatcatttgaccgctgcaa
agcaattcgaactattcgaacgtaacgaagcacaacaaggtcgtcaagttaccggaaaat
ggtcttggctagcaccgccattatctccaacattgacgtcaaattatcatcacggatatg
acaatacagtaaaagatccaaactttttctataaaaagaaagaatcaaatgctaaccagt
gccctttccatcattaagttagtagaggtgtagcatatgcaattatattatttaggccct
aaaggtacattttcatatttggcttgtcgtcagtatttttctgaaaatgaagcaactttt
caaccaaagtcaaatttttttgaagtcatcaaggcagttgcagatgatgacacatcgatt
ggtgttgtccctattgaaaattctatagaaggaacaatcaacattgtggcagatgcactt
gcacagcaagatgtctttgcacacggtgaaatacgtttagatattaactttgcattatat
ggtaatggaacagattccatttctgatattaaaaaagtgtattctattgcaccagcaatc
agtcaaacaacaaattacatacatcaacatcaatttgactatgattatgtcgacagtaca
attcaaagtttgactaaaattgaaaatggcgttgcagcaattgcacctttaggtagtggc
gaagcttatggttttacacctattgatacacatattg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004517       F:nitric-oxide synthase activity
GO:0006809       P:nitric oxide biosynthetic process
GO:0020037       F:heme binding
GO:0055114       P:oxidation reduction
cmr|NT01SA1895 Staphylococcus aureus N315     Nitric oxide synthase, oxygenase domain
cmr|NT02SA1926 Staphylococcus aureus Mu50     Nitric oxide synthase, oxygenase domain
cmr|NT03SA2011 Staphylococcus aureus MW2     Nitric oxide synthase, oxygenase domain
cmr|NT05SA1928 Staphylococcus aureus NCTC 8325     nitric oxide synthase, oxygenase domain
cmr|NT09SA1857 Staphylococcus aureus subsp. aureus MSSA476     Nitric oxide synthase, oxygenase domain
cmr|SACOL1976 Staphylococcus aureus subsp. aureus COL     nitric-oxide synthase, oxygenase subunit
cmr|SAUSA300_1895 Staphylococcus aureus subsp. aureus USA300-FPR3757     nitric oxide synthase oxygenase
dbj|BAB43000.1 Staphylococcus aureus subsp. aureus N315     SA1730
dbj|BAB58076.1 Staphylococcus aureus subsp. aureus Mu50     nitric-oxide synthase homolog
dbj|BAB95720.1 Staphylococcus aureus subsp. aureus MW2     MW1855
dbj|BAF68124.1 Staphylococcus aureus subsp. aureus str. Newman     nitric oxide synthase oxygenase
dbj|BAF78782.1 Staphylococcus aureus subsp. aureus Mu3     nitric-oxide synthase homolog
emb|CAG43643.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative oxygenase
fig|158878.1.peg.1914 Staphylococcus aureus subsp. aureus Mu50 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|158878.14.peg.1982 Staphylococcus aureus subsp. aureus Mu50 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|158879.1.peg.1783 Staphylococcus aureus subsp. aureus N315 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|158879.11.peg.1867 Staphylococcus aureus subsp. aureus N315 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|196620.1.peg.1855 Staphylococcus aureus subsp. aureus MW2 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|196620.5.peg.1930 Staphylococcus aureus subsp. aureus MW2 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|282459.1.peg.1822 Staphylococcus aureus subsp. aureus MSSA476 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|282459.5.peg.1915 Staphylococcus aureus subsp. aureus MSSA476 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|359786.13.peg.2084 Staphylococcus aureus subsp. aureus JH9 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|359786.3.peg.1603 Staphylococcus aureus subsp. aureus JH9 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|359787.11.peg.2055 Staphylococcus aureus subsp. aureus JH1 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|359787.3.peg.2672 Staphylococcus aureus subsp. aureus JH1 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|367830.3.peg.1952 Staphylococcus aureus subsp. aureus USA300 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|418127.4.peg.1771 Staphylococcus aureus subsp. aureus Mu3 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|418127.6.peg.1954 Staphylococcus aureus subsp. aureus Mu3 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|426430.6.peg.1801 Staphylococcus aureus subsp. aureus str. Newman FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|426430.8.peg.2015 Staphylococcus aureus subsp. aureus str. Newman FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|450394.6.peg.2434 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|451516.9.peg.2010 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|452948.4.peg.2038 Staphylococcus aureus 930918-3 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|455227.3.peg.2057 Staphylococcus aureus D30 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|505321.3.peg.2475 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|546342.3.peg.2117 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|546343.3.peg.377 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|548474.3.peg.2563 Staphylococcus aureus subsp. aureus TCH130 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|548475.3.peg.2491 Staphylococcus aureus subsp. aureus TCH70 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553565.3.peg.58 Staphylococcus aureus A5937 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553567.3.peg.496 Staphylococcus aureus A5948 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553573.3.peg.1270 Staphylococcus aureus A8115 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553574.3.peg.1913 Staphylococcus aureus A8117 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553577.3.peg.2228 Staphylococcus aureus A8796 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553580.3.peg.2438 Staphylococcus aureus A8819 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553581.3.peg.393 Staphylococcus aureus A9299 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553588.3.peg.1346 Staphylococcus aureus A9719 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553590.4.peg.1530 Staphylococcus aureus A9754 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553592.3.peg.1905 Staphylococcus aureus A9763 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|553596.3.peg.157 Staphylococcus aureus A9781 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|585152.3.peg.1891 Staphylococcus aureus subsp. aureus D139 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|585155.3.peg.2509 Staphylococcus aureus subsp. aureus H19 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|585891.3.peg.1980 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|644279.4.peg.2067 Staphylococcus aureus subsp. aureus 132 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|680649.3.peg.999 Staphylococcus aureus subsp. aureus MR1 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|681288.4.peg.1951 Staphylococcus aureus subsp. aureus ED98 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|703339.3.peg.1911 Staphylococcus aureus 04-02981 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|762962.3.peg.2505 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|93061.3.peg.2016 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|93061.5.peg.1936 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|93062.19.peg.1930 Staphylococcus aureus subsp. aureus COL FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
fig|93062.4.peg.1943 Staphylococcus aureus subsp. aureus COL FIG   Nitric-oxide synthase (flavodoxin) (EC 1.14.14.47)
gb|AAW36946.1 Staphylococcus aureus subsp. aureus COL     nitric-oxide synthase, oxygenase subunit
gb|ABD22609.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     nitric oxide synthase oxygenase
gb|ABD31182.1 Staphylococcus aureus subsp. aureus NCTC 8325     nitric oxide synthase, oxygenase domain, putative
gb|ABQ49755.1 Staphylococcus aureus subsp. aureus JH9     Nitric-oxide synthase
gb|ABR52838.1 Staphylococcus aureus subsp. aureus JH1     Nitric-oxide synthase
gb|ABX29918.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     nitric-oxide synthase, oxygenase subunit
gb|EES54101.1 Staphylococcus aureus subsp. aureus TCH70     nitric-oxide synthase, oxygenase subunit
gb|EES95308.1 Staphylococcus aureus subsp. aureus USA300_TCH959     nitric-oxide synthase, oxygenase subunit
gb|EES95885.1 Staphylococcus aureus subsp. aureus TCH130     nitric-oxide synthase, oxygenase subunit
gb|EEV25610.1 Staphylococcus aureus A9781     nitric oxide synthase, oxygenase domain-containing protein
gb|EEV64012.1 Staphylococcus aureus A9763     nitric oxide synthase oxygenase subunit
gb|EEV67389.1 Staphylococcus aureus A9719     nitric oxide synthase
gb|EEV73567.1 Staphylococcus aureus A9299     nitric oxide synthase oxygenase
gb|EEV75302.1 Staphylococcus aureus A8115     nitric-oxide synthase
gb|EEV84073.1 Staphylococcus aureus A5948     nitric oxide synthase, oxygenase domain-containing protein
gb|EEV87283.1 Staphylococcus aureus A5937     nitric oxide synthase, oxygenase domain-containing protein
gb|EEW44349.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0495
gb|EEW46543.1 Staphylococcus aureus D30     hypothetical protein SAD30_1423
gi|13701707 Staphylococcus aureus subsp. aureus N315 NCBI   SA1730
gi|14247686 Staphylococcus aureus subsp. aureus Mu50 NCBI   nitric-oxide synthase homolog
gi|147741457 Staphylococcus aureus subsp. aureus JH9 NCBI   Nitric-oxide synthase
gi|148268388 Staphylococcus aureus subsp. aureus JH9 NCBI   nitric-oxide synthase
gi|149946902 Staphylococcus aureus subsp. aureus JH1 NCBI   Nitric-oxide synthase
gi|150374864 Staphylococcus aureus subsp. aureus str. Newman NCBI   nitric oxide synthase oxygenase
gi|150394450 Staphylococcus aureus subsp. aureus JH1 NCBI   nitric-oxide synthase
gi|151222064 Staphylococcus aureus subsp. aureus str. Newman NCBI   nitric oxide synthase oxygenase
gi|156722365 Staphylococcus aureus subsp. aureus Mu3 NCBI   nitric-oxide synthase homolog
gi|156980230 Staphylococcus aureus subsp. aureus Mu3 NCBI   nitric-oxide synthase-like protein
gi|15924904 Staphylococcus aureus subsp. aureus Mu50 NCBI   nitric-oxide synthase-like protein
gi|15927488 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1730
gi|160368947 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   nitric-oxide synthase, oxygenase subunit
gi|161510138 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   nitric-oxide synthase, oxygenase subunit
gi|21205025 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1855
gi|21283584 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1855
gi|221139073 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   nitric-oxide synthase, oxygenase subunit
gi|221140368 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   nitric-oxide synthase, oxygenase subunit
gi|251801444 Staphylococcus aureus subsp. aureus TCH70 NCBI   nitric-oxide synthase, oxygenase subunit
gi|251815028 Staphylococcus aureus subsp. aureus TCH70 NCBI   nitric-oxide synthase, oxygenase subunit
gi|253316924 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   nitric oxide synthase oxygenase
gi|253726579 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   nitric-oxide synthase, oxygenase subunit
gi|253727156 Staphylococcus aureus subsp. aureus TCH130 NCBI   nitric-oxide synthase, oxygenase subunit
gi|253729693 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   nitric-oxide synthase, oxygenase subunit
gi|253734974 Staphylococcus aureus subsp. aureus TCH130 NCBI   nitric-oxide synthase, oxygenase subunit
gi|255006702 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   nitric oxide synthase oxygenase
gi|257787270 Staphylococcus aureus A9781 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|257793298 Staphylococcus aureus A9781 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|257839542 Staphylococcus aureus A9763 NCBI   nitric oxide synthase oxygenase subunit
gi|257842971 Staphylococcus aureus A9719 NCBI   nitric oxide synthase
gi|257849599 Staphylococcus aureus A9299 NCBI   nitric oxide synthase oxygenase
gi|257851362 Staphylococcus aureus A8115 NCBI   nitric-oxide synthase
gi|257861261 Staphylococcus aureus A5948 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|257864540 Staphylococcus aureus A5937 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|258413589 Staphylococcus aureus A9763 NCBI   nitric oxide synthase oxygenase subunit
gi|258421023 Staphylococcus aureus A9719 NCBI   nitric oxide synthase
gi|258430005 Staphylococcus aureus A9299 NCBI   nitric oxide synthase oxygenase
gi|258443477 Staphylococcus aureus A8115 NCBI   nitric-oxide synthase
gi|258451019 Staphylococcus aureus A5948 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|258453332 Staphylococcus aureus A5937 NCBI   nitric oxide synthase, oxygenase domain-containing protein
gi|259159292 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0495
gi|259161961 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1423
gi|49245177 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative oxygenase
gi|49486734 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative oxygenase
gi|57284852 Staphylococcus aureus subsp. aureus COL NCBI   nitric-oxide synthase, oxygenase subunit
gi|57650666 Staphylococcus aureus subsp. aureus COL NCBI   nitric-oxide synthase, oxygenase subunit
gi|60390416 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|60392833 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|60392834 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|60392835 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|60392836 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|81694148 organism not parsed/found in ncbi nr NCBI   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
gi|87128095 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   nitric oxide synthase oxygenase
gi|87162121 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   nitric oxide synthase oxygenase
gi|87203372 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   nitric oxide synthase, oxygenase domain, putative
gi|88195814 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   nitric oxide synthase oxygenase subunit
img|637093437 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100460 Staphylococcus aureus aureus Mu50 IMG   nitric-oxide synthase homolog
img|637152739 Staphylococcus aureus aureus COL IMG   nitric-oxide synthase, oxygenase subunit
img|637158098 Staphylococcus aureus aureus MSSA476 IMG   putative oxygenase
img|637299658 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888541 Staphylococcus aureus aureus USA300 IMG   nitric oxide synthase oxygenase
img|637894758 Staphylococcus aureus aureus NCTC 8325 IMG   nitric oxide synthase, oxygenase domain, putative
img|639108792 Staphylococcus aureus aureus JH1 IMG   Nitric-oxide synthase( EC:1.14.13.39 )
img|640566347 Staphylococcus aureus aureus JH9 IMG   Nitric-oxide synthase( EC:1.14.13.39 )
img|640780111 Staphylococcus aureus aureus JH1 IMG   Nitric-oxide synthase( EC:1.14.13.39 )
img|640796269 Staphylococcus aureus aureus Newman IMG   nitric oxide synthase oxygenase
img|640904683 Staphylococcus aureus aureus Mu3 IMG   nitric-oxide synthase homolog
img|641309914 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   nitric-oxide synthase, oxygenase subunit( EC:1.14.13.39 )
img|641771736 Staphylococcus aureus aureus USA300_TCH959 IMG   nitric-oxide synthase, oxygenase subunit
kegg|saa:SAUSA300_1895 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   nitric oxide synthase oxygenase
kegg|sac:SACOL1976 Staphylococcus aureus subsp. aureus COL KEGG   nitric-oxide synthase, oxygenase subunit
kegg|sae:NWMN_1852 Staphylococcus aureus subsp. aureus Newman KEGG   nitric oxide synthase oxygenase
kegg|sah:SaurJH1_2004 Staphylococcus aureus subsp. aureus JH1 KEGG   nitric-oxide synthase (EC:1.14.13.39)
kegg|saj:SaurJH9_1970 Staphylococcus aureus subsp. aureus JH9 KEGG   nitric-oxide synthase (EC:1.14.13.39)
kegg|sam:MW1855 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02134 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   nitric oxide synthase oxygenase subunit
kegg|sas:SAS1838   KEGG   putative oxygenase
kegg|sau:SA1730   KEGG   hypothetical protein
kegg|sav:SAV1914   KEGG   nitric-oxide synthase-like protein
kegg|saw:SAHV_1899 Staphylococcus aureus subsp. aureus Mu3 KEGG   nitric-oxide synthase-like protein
kegg|sax:USA300HOU_1916 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   nitric-oxide synthase, oxygenase subunit (EC:1.14.13.39)
ref|NP_372438.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   nitric-oxide synthase-like protein
ref|NP_375021.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1730
ref|NP_646672.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1855
ref|YP_001247331.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   nitric-oxide synthase
ref|YP_001317125.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   nitric-oxide synthase
ref|YP_001332886.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   nitric oxide synthase oxygenase
ref|YP_001442489.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   nitric-oxide synthase-like protein
ref|YP_001575797.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|YP_043955.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative oxygenase
ref|YP_186800.1 Staphylococcus aureus subsp. aureus COL RefSeq   nitric-oxide synthase, oxygenase subunit
ref|YP_494547.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   nitric oxide synthase oxygenase
ref|YP_500624.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   nitric oxide synthase oxygenase subunit
ref|ZP_03563873.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|ZP_03564861.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|ZP_04829501.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|ZP_04840137.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   nitric oxide synthase oxygenase
ref|ZP_04863858.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|ZP_04869139.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   nitric-oxide synthase, oxygenase subunit
ref|ZP_05145303.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   nitric oxide synthase oxygenase
ref|ZP_05642277.1 Staphylococcus aureus A9781 RefSeq   nitric oxide synthase, oxygenase domain-containing protein
ref|ZP_05681863.1 Staphylococcus aureus A9763 RefSeq   nitric oxide synthase oxygenase subunit
ref|ZP_05683954.1 Staphylococcus aureus A9719 RefSeq   nitric oxide synthase
ref|ZP_05688375.1 Staphylococcus aureus A9299 RefSeq   nitric oxide synthase oxygenase
ref|ZP_05691819.1 Staphylococcus aureus A8115 RefSeq   nitric-oxide synthase
ref|ZP_05699055.1 Staphylococcus aureus A5948 RefSeq   nitric oxide synthase, oxygenase domain-containing protein
ref|ZP_05701317.1 Staphylococcus aureus A5937 RefSeq   nitric oxide synthase, oxygenase domain-containing protein
sp|NOSO_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|NOSO_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|NOSO_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|NOSO_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|NOSO_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|NOSO_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Nitric oxide synthase oxygenase; AltName: Full=NOSoxy-like protein; AltName: Full=SANOS
sp|P0A004 Staphylococcus aureus SwissProt   Nitric oxide synthase oxygenase
sp|P0A092 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Nitric oxide synthase oxygenase
sp|P0A093 Staphylococcus aureus (strain N315) SwissProt   Nitric oxide synthase oxygenase
sp|P0A094 Staphylococcus aureus (strain MW2) SwissProt   Nitric oxide synthase oxygenase
sp|Q5HEK7 Staphylococcus aureus (strain COL) SwissProt   Nitric oxide synthase oxygenase
sp|Q6G818 Staphylococcus aureus (strain MSSA476) SwissProt   Nitric oxide synthase oxygenase
tr|A5IU82 Staphylococcus aureus (strain JH9) TrEMBL   Nitric-oxide synthase
tr|A6QIE2 Staphylococcus aureus (strain Newman) TrEMBL   Nitric oxide synthase oxygenase
tr|A6U320 Staphylococcus aureus (strain JH1) TrEMBL   Nitric-oxide synthase
tr|A7X445 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Nitric-oxide synthase homolog
tr|A8Z2S9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Nitric-oxide synthase, oxygenase subunit
tr|C5MYS0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Nitric-oxide synthase, oxygenase subunit
tr|C5Q4S0 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Nitric-oxide synthase, oxygenase subunit
tr|C5QL35 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Nitric-oxide synthase, oxygenase subunit
tr|Q2FFI1 Staphylococcus aureus (strain USA300) TrEMBL   Nitric oxide synthase oxygenase
tr|Q2G234 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Nitric oxide synthase, oxygenase domain, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value
evidence_code dlit(12467576);SvetaG


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search