The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.2002: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
Translate Function Assignments



Context on contig NC_007793 from base 2034362 to 2046154 (11793 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1997 2034362 2034862 501 +         dlit(14742543) Bacterial non-heme ferritin (EC 1.16.3.2) locus|SAUSA300_1874, protein_id|YP_494526.1, gi|87161737, geneID|3913023
1998 2035251 2035805 555 + 388         DNA polymerase III polC-type (EC 2.7.7.7) locus|SAUSA300_1875, protein_id|YP_494527.1, gi|87160447, geneID|3912950
1999 2036943 2035873 1071 - 67     1: 5   DNA polymerase IV (EC 2.7.7.7) locus|SAUSA300_1876, protein_id|YP_494528.1, gi|87162181, geneID|3913878
2000 2037720 2037190 531 - 246         Hypothetical protein SAV1896 locus|SAUSA300_1877, protein_id|YP_494529.1, gi|87161576, geneID|3913645
2001 2039251 2037890 1362 - 169 9 1: 6   RNA methyltransferase, TrmA family gene_name|rumA, locus|SAUSA300_1878, protein_id|YP_494530.1, gi|87160330, geneID|3915405
2002 2040279 2039332 948 - 80       Diacylglycerol kinase, Bacillus type (EC 2.7.1.107) locus|SAUSA300_1879, protein_id|YP_494531.1, gi|87160862, geneID|3914133
2003 2041008 2040862 147 - 582         FIG01107968: hypothetical protein  
2004 2042475 2041048 1428 - 39     1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit B (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit B (EC 6.3.5.7) gene_name|gatB, locus|SAUSA300_1880, protein_id|YP_494532.1, gi|87162372, geneID|3913525
2005 2043945 2042488 1458 - 12 8 1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7) gene_name|gatA, locus|SAUSA300_1881, protein_id|YP_494533.1, gi|87161785, geneID|3914028
2006 2044249 2043947 303 - 1 9 1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7) gene_name|gatC, locus|SAUSA300_1882, protein_id|YP_494534.1, gi|87160559, geneID|3913514
2007 2044616 2046154 1539 + 366     3: 3 4 2   Pantothenate:Na+ symporter (TC 2.A.21.1.1) gene_name|putP, locus|SAUSA300_1883, protein_id|YP_494535.1, gi|87160016, geneID|3912927

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.2002 Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE

MD5 = 66b360f4e9d6667abf1791952e7ad6f9


  DNA Sequence

>fig|451515.3.peg.2002 Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.2002 Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
agtctatataatgaagaacggcaaaaaatgctgaataaataacaagctttgtacatattg
agatagtatttgtttaagatacaagttggtctttaacgatattaagaatgatgaaataag
actgagcctgggtcataaattcaatgtcctaggcactacaatgttatattggctgtagtt
gactgaaagaaaatacgcttgtaacaagcttttttcaattctagtggggccccaacatag
aagctgactttctgtcagcttacaataatgtgcaagttggcggggcccccaaacaaagaa
gctgactttctgtcagcttacaataatgtgcaagttggggtggggccccaacatagagaa
tttcgaaaggaaattctacagacaatgcaagttggggtagaacgaaataaattttgttaa
atattatttctgtcccactccctattagacgaaacaaagatgaagttaaaatatatgaat
tttaagtagagggataagatatgaggaaacgtgctagaatcatttataacccgacatcag
gtaaagagctatttaaaagagaattacctgatgccttaataaaattagaaaaagcgggat
atgaaacgagtgcatatgcaaccgagaaaataggtgatgccacacttgaagcagaaagag
ctatgcatgaaaattatgatgtattaatcgctgcaggtggtgatggaacattaaatgaag
tagttaatggtatcgcagaaaagcctaatcgtcctaagctaggtgtcattcctatgggta
ctgttaatgactttggacgtgcattgcatatacctaatgacatcatgggggcacttgatg
tcatcattgaaggtcattctactaaagtagatattggtaaaatgaataatcgatacttta
ttaatttagctgcaggcggacaattgacgcaagtctcttatgaaacaccgagtaaattga
aatctattgttggtccatttgcttattacatcaaaggtttcgaaatgttacctcaaatga
aagctgtagatttaagaattgaatatgatggtaatgttttccaaggagaagcattattat
tctttttaggtttaacaaattcaatggcaggatttgaaaaattagtgccggacgctaagt
tagatgacggctattttacgttaattatagttgaaaaatcaaaccttgcagaacttggtc
atattatgactttagcttcaagaggagaacatactaagcatcctaaagttatttatgaaa
aagcaaaggcaattaatatttcatcattcacagacttacaactaaatgtagatggagaat
atggtggtaaattaccagcgaatttcttaaatctagaacgtcatatagatgtctttgcac
ctaatgatattgtaaatgaagagttaataaataatgatcatgttgatgacaatttaatcg
aagaataaacagaaatagtgaaatatataatggcaggttaggaagcgcataattttgttc
ctaacctgttcattttggaggtaaaattttgcaagcaatagctaaaaatgacataaaaac
gggaacagttgttgatttaacgcatgaaggccatggtgtcgtaaaaatagatcgctttcc
tattttcataccacaagctttaattaatgaacaaattgaatataaaattatcaaagtaaa
aaagaactttgcgataggtaagttgcttaatataaatacgagaagtgagaatcgtgttgc
accgccatgtatatattatgaacgttgtggtgggtgccaacttcaacacttatcatacga
agcacaacttgaaatgaaaaaggaacaagtgattaatttgtttcagcgaaaagcgcattt
tgataattctaagattaacgatacagttggcatgacagatccttggagatatcgaaacaa
gtcccagattccagttggtaagaatgaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004143       F:diacylglycerol kinase activity
GO:0007205       P:activation of protein kinase C activity
cmr|NT01SA1877 Staphylococcus aureus N315     conserved hypothetical protein TIGR00147
cmr|NT02SA1909 Staphylococcus aureus Mu50     conserved hypothetical protein TIGR00147
cmr|NT03SA1993 Staphylococcus aureus MW2     conserved hypothetical protein TIGR00147
cmr|NT05SA1912 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA1840 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein TIGR00147
cmr|SACOL1958 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein TIGR00147
cmr|SAUSA300_1879 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB42984.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB58060.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB95704.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF68108.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF78766.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG43626.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|158878.1.peg.1898 Staphylococcus aureus subsp. aureus Mu50 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|158878.14.peg.1963 Staphylococcus aureus subsp. aureus Mu50 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|158879.1.peg.1767 Staphylococcus aureus subsp. aureus N315 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|158879.11.peg.1848 Staphylococcus aureus subsp. aureus N315 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|196620.1.peg.1839 Staphylococcus aureus subsp. aureus MW2 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|196620.5.peg.1912 Staphylococcus aureus subsp. aureus MW2 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|282459.1.peg.1805 Staphylococcus aureus subsp. aureus MSSA476 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|282459.5.peg.1897 Staphylococcus aureus subsp. aureus MSSA476 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|359786.13.peg.2065 Staphylococcus aureus subsp. aureus JH9 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|359786.3.peg.582 Staphylococcus aureus subsp. aureus JH9 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|359787.11.peg.2038 Staphylococcus aureus subsp. aureus JH1 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|359787.3.peg.2680 Staphylococcus aureus subsp. aureus JH1 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|367830.3.peg.1936 Staphylococcus aureus subsp. aureus USA300 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|418127.4.peg.1754 Staphylococcus aureus subsp. aureus Mu3 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|418127.6.peg.1937 Staphylococcus aureus subsp. aureus Mu3 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|426430.6.peg.1784 Staphylococcus aureus subsp. aureus str. Newman FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|426430.8.peg.1997 Staphylococcus aureus subsp. aureus str. Newman FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|451516.9.peg.1992 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|452948.4.peg.2593 Staphylococcus aureus 930918-3 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|455227.3.peg.2040 Staphylococcus aureus D30 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|505321.3.peg.2457 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|546342.3.peg.2389 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|546343.3.peg.1214 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|548475.3.peg.2509 Staphylococcus aureus subsp. aureus TCH70 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553565.3.peg.39 Staphylococcus aureus A5937 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553567.3.peg.514 Staphylococcus aureus A5948 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553568.3.peg.197 Staphylococcus aureus A6224 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553571.3.peg.364 Staphylococcus aureus A6300 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553573.3.peg.1251 Staphylococcus aureus A8115 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553574.3.peg.1896 Staphylococcus aureus A8117 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553577.3.peg.2247 Staphylococcus aureus A8796 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553580.3.peg.2419 Staphylococcus aureus A8819 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553581.3.peg.410 Staphylococcus aureus A9299 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553588.3.peg.1327 Staphylococcus aureus A9719 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553590.4.peg.1513 Staphylococcus aureus A9754 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553592.3.peg.1189 Staphylococcus aureus A9763 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553594.3.peg.1595 Staphylococcus aureus A9765 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553596.3.peg.614 Staphylococcus aureus A9781 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|553601.3.peg.1584 Staphylococcus aureus A10102 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|585891.3.peg.1961 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|644279.4.peg.2049 Staphylococcus aureus subsp. aureus 132 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|680649.3.peg.2279 Staphylococcus aureus subsp. aureus MR1 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|681288.4.peg.1932 Staphylococcus aureus subsp. aureus ED98 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|703339.3.peg.1892 Staphylococcus aureus 04-02981 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|762962.3.peg.2487 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|93061.3.peg.1998 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|93061.5.peg.1918 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|93062.19.peg.1912 Staphylococcus aureus subsp. aureus COL FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
fig|93062.4.peg.379 Staphylococcus aureus subsp. aureus COL FIG   Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
gb|AAW38399.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein TIGR00147
gb|ABD21350.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31164.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ49737.1 Staphylococcus aureus subsp. aureus JH9     diacylglycerol kinase
gb|ABR52820.1 Staphylococcus aureus subsp. aureus JH1     diacylglycerol kinase catalytic region
gb|ABX29900.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1897
gb|EES54120.1 Staphylococcus aureus subsp. aureus TCH70     lipid kinase
gb|EEV26060.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV64799.1 Staphylococcus aureus A9763     diacylglycerol kinase
gb|EEV67372.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73584.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV75285.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78760.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81683.1 Staphylococcus aureus A6224     diacylglycerol kinase
gb|EEV84090.1 Staphylococcus aureus A5948     diacylglycerol kinase
gb|EEV87266.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW44005.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1197
gb|EEW46532.1 Staphylococcus aureus D30     hypothetical protein SAD30_1412
gi|13701691 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14247670 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147741439 Staphylococcus aureus subsp. aureus JH9 NCBI   diacylglycerol kinase
gi|148268370 Staphylococcus aureus subsp. aureus JH9 NCBI   putative lipid kinase
gi|149946884 Staphylococcus aureus subsp. aureus JH1 NCBI   diacylglycerol kinase catalytic region
gi|150374848 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150394432 Staphylococcus aureus subsp. aureus JH1 NCBI   putative lipid kinase
gi|151222048 Staphylococcus aureus subsp. aureus str. Newman NCBI   putative lipid kinase
gi|156722349 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156980214 Staphylococcus aureus subsp. aureus Mu3 NCBI   putative lipid kinase
gi|15924888 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative lipid kinase
gi|15927472 Staphylococcus aureus subsp. aureus N315 NCBI   putative lipid kinase
gi|160368929 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1897
gi|161510120 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   putative lipid kinase
gi|21205009 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21283568 Staphylococcus aureus subsp. aureus MW2 NCBI   putative lipid kinase
gi|221139339 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   putative lipid kinase
gi|221141188 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   putative lipid kinase
gi|251801463 Staphylococcus aureus subsp. aureus TCH70 NCBI   lipid kinase
gi|251815047 Staphylococcus aureus subsp. aureus TCH70 NCBI   lipid kinase
gi|253316907 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative lipid kinase
gi|255006685 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   putative lipid kinase
gi|257787720 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257793748 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840337 Staphylococcus aureus A9763 NCBI   diacylglycerol kinase
gi|257842954 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849616 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257851345 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855836 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858814 Staphylococcus aureus A6224 NCBI   diacylglycerol kinase
gi|257861278 Staphylococcus aureus A5948 NCBI   diacylglycerol kinase
gi|257864523 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408890 Staphylococcus aureus A9763 NCBI   diacylglycerol kinase
gi|258421006 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258430022 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258443460 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445318 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258447882 Staphylococcus aureus A6224 NCBI   diacylglycerol kinase
gi|258451036 Staphylococcus aureus A5948 NCBI   diacylglycerol kinase
gi|258453315 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259158919 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1197
gi|259161950 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1412
gi|49245160 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49486717 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative lipid kinase
gi|57286305 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein TIGR00147
gi|57652119 Staphylococcus aureus subsp. aureus COL NCBI   putative lipid kinase
gi|87126836 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160862 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipid kinase
gi|87203354 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195796 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   putative lipid kinase
img|637093421 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100444 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637152722 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637158081 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299642 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888525 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894740 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108808 Staphylococcus aureus aureus JH1 IMG   Conserved hypothetical protein 147
img|640566329 Staphylococcus aureus aureus JH9 IMG   diacylglycerol kinase, catalytic region
img|640780093 Staphylococcus aureus aureus JH1 IMG   diacylglycerol kinase catalytic region
img|640796253 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640904667 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641309896 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641773592 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1879 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative lipid kinase
kegg|sac:SACOL1958 Staphylococcus aureus subsp. aureus COL KEGG   putative lipid kinase
kegg|sae:NWMN_1836 Staphylococcus aureus subsp. aureus Newman KEGG   putative lipid kinase
kegg|sah:SaurJH1_1986 Staphylococcus aureus subsp. aureus JH1 KEGG   putative lipid kinase
kegg|saj:SaurJH9_1952 Staphylococcus aureus subsp. aureus JH9 KEGG   putative lipid kinase
kegg|sam:MW1839 Staphylococcus aureus subsp. aureus MW2 KEGG   putative lipid kinase
kegg|sao:SAOUHSC_02114 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   putative lipid kinase
kegg|sas:SAS1820   KEGG   putative lipid kinase
kegg|sau:SA1714   KEGG   putative lipid kinase
kegg|sav:SAV1898   KEGG   putative lipid kinase
kegg|saw:SAHV_1883 Staphylococcus aureus subsp. aureus Mu3 KEGG   putative lipid kinase
kegg|sax:USA300HOU_1897 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   putative lipid kinase
ref|NP_372422.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   putative lipid kinase
ref|NP_375005.1 Staphylococcus aureus subsp. aureus N315 RefSeq   putative lipid kinase
ref|NP_646656.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   putative lipid kinase
ref|YP_001247313.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   putative lipid kinase
ref|YP_001317107.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   putative lipid kinase
ref|YP_001332870.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   putative lipid kinase
ref|YP_001442473.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   putative lipid kinase
ref|YP_001575779.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   putative lipid kinase
ref|YP_043938.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative lipid kinase
ref|YP_186783.1 Staphylococcus aureus subsp. aureus COL RefSeq   putative lipid kinase
ref|YP_494531.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative lipid kinase
ref|YP_500606.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   putative lipid kinase
ref|ZP_03564138.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   putative lipid kinase
ref|ZP_03565681.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   putative lipid kinase
ref|ZP_04829520.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   lipid kinase
ref|ZP_04840120.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative lipid kinase
ref|ZP_05145286.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   putative lipid kinase
ref|ZP_05642727.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05681172.1 Staphylococcus aureus A9763 RefSeq   diacylglycerol kinase
ref|ZP_05683937.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688392.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691802.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693509.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696016.1 Staphylococcus aureus A6224 RefSeq   diacylglycerol kinase
ref|ZP_05699072.1 Staphylococcus aureus A5948 RefSeq   diacylglycerol kinase
ref|ZP_05701300.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IU64 Staphylococcus aureus (strain JH9) TrEMBL   Diacylglycerol kinase
tr|A6QIC6 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6U302 Staphylococcus aureus (strain JH1) TrEMBL   Diacylglycerol kinase catalytic region
tr|A7X424 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z2R1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5QL54 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Lipid kinase
tr|Q2FFJ7 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FWZ2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HEM4 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G835 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q7A0H3 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1839
tr|Q7A4Q8 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1714
tr|Q99SY8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|451515.3.peg.2001 RNA methyltransferase, TrmA family
8 fig|451515.3.peg.2005 Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7)
9 fig|451515.3.peg.2006 Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search