The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1913: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: serine protease
Translate Function Assignments



Context on contig NC_007793 from base 1935644 to 1946372 (10729 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1909 1936843 1935644 1200 -       3: 1 3 2   Type I restriction-modification system, specificity subunit S (EC 3.1.21.3) gene_name|hsdS, locus|SAUSA300_1751, protein_id|YP_494442.1, gi|87161451, geneID|3914124
1910 1938392 1936836 1557 - -8     3: 1 3 2   Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72) gene_name|hsdM, locus|SAUSA300_1752, protein_id|YP_494443.1, gi|87161919, geneID|3913010
1911 1939474 1938755 720 - 362         serine protease gene_name|splF, locus|SAUSA300_1753, protein_id|YP_494444.1, gi|87161318, geneID|3914815
1912 1940341 1939625 717 - 150         serine protease gene_name|splE, locus|SAUSA300_1754, protein_id|YP_494445.1, gi|87161916, geneID|3913007
1913 1941218 1940499 720 - 157         serine protease gene_name|splD, locus|SAUSA300_1755, protein_id|YP_494446.1, gi|87160514, geneID|3914726
1914 1942058 1941339 720 - 120         serine protease gene_name|splC, locus|SAUSA300_1756, protein_id|YP_494447.1, gi|87160903, geneID|3915154
1915 1942838 1942116 723 - 57         serine protease gene_name|splB, locus|SAUSA300_1757, protein_id|YP_494448.1, gi|87161649, geneID|3913151
1916 1943670 1942963 708 - 124         serine protease gene_name|splA, locus|SAUSA300_1758, protein_id|YP_494449.1, gi|87161397, geneID|3914167
1917 1944324 1944106 219 - 435         Hypothetical protein within pathogenicity island SaPIn3  
1918 1944634 1945200 567 + 309         probable beta-lactamase locus|SAUSA300_1759, protein_id|YP_494450.1, gi|87162106, geneID|3913100
1919 1946372 1945674 699 - 473         BsaG protein gene_name|epiG, locus|SAUSA300_1760, protein_id|YP_494451.1, gi|87160206, geneID|3913079

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.1913 serine protease
MNKNIIIKSIAALTILTSITGVGTTVVDGIQQTAKAENSVKLITNTNVAPYSGVTWMGAG
TGFVVGNHTIITNKHVTYHMKVGDEIKAHPNGFYNNGGGLYKVTKIVDYPGKEDIAVVQV
EEKSTQPKGRKFKDFTSKFNIASEAKENEPISVIGYPNPNGNKLQMYESTGKVLSVNGNI
VTSDAVVQPGSSGSPILNSKREAIGVMYASDKPTGESTRSFAVYFSPEIKKFIADNLDK

MD5 = d026ca592854531df528d5210100d88a


  DNA Sequence

>fig|451515.3.peg.1913 serine protease
atgaataaaaatataatcatcaaaagtattgcggcattgacgattttaacatcaataact
ggtgtcggcacaacagtggttgatggtattcaacaaacagccaaagcagaaaatagtgtg
aaattaattaccaacacgaatgttgcaccatacagtggtgttacatggatgggcgctgga
acaggatttgtagttgggaatcatacaatcattaccaataaacatgttacttatcacatg
aaagtcggtgatgaaatcaaagcacatcctaatggtttttataataacggtggtggactt
tataaagttactaagattgtagattatcctggtaaagaagatattgcggtcgtacaagtt
gaagaaaaatcaacgcaaccaaaaggtagaaaattcaaagatttcactagcaaatttaat
atagcatcagaagctaaagaaaatgaacctatatcagtcattggttatccaaatcctaat
ggaaataaactacaaatgtatgaatcaactggtaaagtactatcagtgaatggaaatata
gtgacatctgatgcggttgtccaacctggcagctctggttcacctatattaaatagtaag
cgagaagcaattggtgttatgtatgctagtgataaaccaacaggtgaaagtacaaggtca
tttgctgtttatttctctcctgaaattaagaaatttattgcagataatttagataaataa


  DNA with Flanking Sequence

>fig|451515.3.peg.1913 serine protease
tctctgtcatgaatattgaagaacaagcagtcgaacgtggaccaaaaggctttaatttta
atgaaaatgtccaagcattcaattttgcgaaagatgctaaagttgatgacaaaattaaag
ttattggttacccattacctgctcaaaatagttttaaacagtttgaatctacaggaacta
taaaaagaatcaaagacaatattttaaattttgatgcatacattgaacccgggaattcag
gatcaccagttctaaattctaacaatgaggtcataggtgtggtgtatggcggtattggaa
aaattggttctgaatataatggtgccgtatactttacgcctcaaatcaaagattttattc
aaaagcacattgaacaataaacaaatttaaatatacaccatgagcatgtgttcaataatt
ttaatgaaaaacatcggtcgaatataacataaaaaaacgtctatatcaaaagcatcatga
ataaacagaggagcacaaaaatgaataaaaatataatcatcaaaagtattgcggcattga
cgattttaacatcaataactggtgtcggcacaacagtggttgatggtattcaacaaacag
ccaaagcagaaaatagtgtgaaattaattaccaacacgaatgttgcaccatacagtggtg
ttacatggatgggcgctggaacaggatttgtagttgggaatcatacaatcattaccaata
aacatgttacttatcacatgaaagtcggtgatgaaatcaaagcacatcctaatggttttt
ataataacggtggtggactttataaagttactaagattgtagattatcctggtaaagaag
atattgcggtcgtacaagttgaagaaaaatcaacgcaaccaaaaggtagaaaattcaaag
atttcactagcaaatttaatatagcatcagaagctaaagaaaatgaacctatatcagtca
ttggttatccaaatcctaatggaaataaactacaaatgtatgaatcaactggtaaagtac
tatcagtgaatggaaatatagtgacatctgatgcggttgtccaacctggcagctctggtt
cacctatattaaatagtaagcgagaagcaattggtgttatgtatgctagtgataaaccaa
caggtgaaagtacaaggtcatttgctgtttatttctctcctgaaattaagaaatttattg
cagataatttagataaataaatcatccatccatacattgataaatgatttttagaaatta
acaacaaaatcaacaattttaaacatctctgtgattctatttattcgaaatgatttaaaa
aataaaacttcaaaaacctaaccttatatttatacgaatacttagaggagcacaaaaatg
aataaaaatataatcatcaaaagtattgcagcattgacgattttaacatcagtgactggc
gtcggcacaacagtggttgagggtattcaacaaacggctaaagctgaacataatgtgaaa
ctaatcaaaaatactaatgtagcaccatacaatggtgtcgtttcgataggatctggaaca
ggtttcattgtcggtaaaaatacaattgttaccaacaagcatgtcgttgcaggtatggaa
attggtgcacatattatagcgcatcccaatggtgaatataataatggcggattttataaa
gttaaaaaaattgtccgttattcaggtcaagaagatattg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004252       F:serine-type endopeptidase activity
GO:0005576       C:extracellular region
GO:0006508       P:proteolysis
cmr|NT01SA1777 Staphylococcus aureus N315     serine protease SplD [imported]
cmr|NT02SA1782 Staphylococcus aureus Mu50     serine proteinase SplD
cmr|NT05SA1723 Staphylococcus aureus NCTC 8325     serine protease SplD
cmr|SAUSA300_1755 Staphylococcus aureus subsp. aureus USA300-FPR3757     serine protease SplD
dbj|BAB42896.1 Staphylococcus aureus subsp. aureus N315     serine protease SplD
dbj|BAB57972.1 Staphylococcus aureus subsp. aureus Mu50     serine protease
dbj|BAF67975.1 Staphylococcus aureus subsp. aureus str. Newman     serine protease SplD
dbj|BAF78678.1 Staphylococcus aureus subsp. aureus Mu3     serine protease
fig|158878.1.peg.1810 Staphylococcus aureus subsp. aureus Mu50 FIG   serine protease
fig|158878.14.peg.1867 Staphylococcus aureus subsp. aureus Mu50 FIG   serine protease
fig|158879.1.peg.1679 Staphylococcus aureus subsp. aureus N315 FIG   serine protease
fig|158879.11.peg.1752 Staphylococcus aureus subsp. aureus N315 FIG   serine protease
fig|367830.3.peg.1398 Staphylococcus aureus subsp. aureus USA300 FIG   serine protease
fig|418127.4.peg.1667 Staphylococcus aureus subsp. aureus Mu3 FIG   serine protease
fig|418127.6.peg.1842 Staphylococcus aureus subsp. aureus Mu3 FIG   serine protease
fig|426430.6.peg.1650 Staphylococcus aureus subsp. aureus str. Newman FIG   serine protease
fig|426430.8.peg.1844 Staphylococcus aureus subsp. aureus str. Newman FIG   serine protease
fig|451516.9.peg.1902 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   serine protease
fig|553565.3.peg.979 Staphylococcus aureus A5937 FIG   serine protease
fig|553567.3.peg.2196 Staphylococcus aureus A5948 FIG   serine protease
fig|553568.3.peg.553 Staphylococcus aureus A6224 FIG   serine protease
fig|553571.3.peg.2324 Staphylococcus aureus A6300 FIG   serine protease
fig|553573.3.peg.1638 Staphylococcus aureus A8115 FIG   serine protease
fig|553574.3.peg.648 Staphylococcus aureus A8117 FIG   serine protease
fig|553588.3.peg.1044 Staphylococcus aureus A9719 FIG   serine protease
fig|553590.4.peg.2293 Staphylococcus aureus A9754 FIG   serine protease
fig|553594.3.peg.1745 Staphylococcus aureus A9765 FIG   serine protease
fig|553596.3.peg.702 Staphylococcus aureus A9781 FIG   serine protease
fig|553601.3.peg.1981 Staphylococcus aureus A10102 FIG   serine protease
fig|585891.3.peg.1864 Staphylococcus aureus subsp. aureus Mu50-omega FIG   serine protease
fig|681288.4.peg.1821 Staphylococcus aureus subsp. aureus ED98 FIG   serine protease
fig|703339.3.peg.1798 Staphylococcus aureus 04-02981 FIG   serine protease
fig|93061.3.peg.1831 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   serine protease
fig|93061.5.peg.1764 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   serine protease
gb|AAF97928.1 Staphylococcus aureus     serine protease SplD
gb|ABD21002.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     serine protease SplD
gb|ABD31001.1 Staphylococcus aureus subsp. aureus NCTC 8325     serine protease SplD
gb|ABX29806.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     S1B family serine protease SplD
gb|AF271715_4 Staphylococcus aureus     serine protease SplD
gb|EEV26142.1 Staphylococcus aureus A9781     serine protease SplD
gb|EEV67734.1 Staphylococcus aureus A9719     serine protease SplD
gb|EEV75178.1 Staphylococcus aureus A8115     serine protease SplD
gb|EEV76827.1 Staphylococcus aureus A6300     serine protease SplD
gb|EEV81347.1 Staphylococcus aureus A6224     serine protease SplD
gb|EEV82522.1 Staphylococcus aureus A5948     serine protease SplD
gb|EEV86448.1 Staphylococcus aureus A5937     serine proteinase SplD
gi|122539235 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|123485321 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|13701603 Staphylococcus aureus subsp. aureus N315 NCBI   serine protease SplD
gi|14247582 Staphylococcus aureus subsp. aureus Mu50 NCBI   serine protease
gi|150374715 Staphylococcus aureus subsp. aureus str. Newman NCBI   serine protease SplD
gi|151221915 Staphylococcus aureus subsp. aureus str. Newman NCBI   serine protease SplD
gi|156722261 Staphylococcus aureus subsp. aureus Mu3 NCBI   serine protease
gi|156980126 Staphylococcus aureus subsp. aureus Mu3 NCBI   serine protease
gi|15924800 Staphylococcus aureus subsp. aureus Mu50 NCBI   serine protease
gi|15927384 Staphylococcus aureus subsp. aureus N315 NCBI   serine protease SplD
gi|160368835 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   S1B family serine protease SplD
gi|161510026 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   serine protease SplD
gi|221222736 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|221222737 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|221222738 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|255006596 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   serine protease SplD
gi|257787802 Staphylococcus aureus A9781 NCBI   serine protease SplD
gi|257793830 Staphylococcus aureus A9781 NCBI   serine protease SplD
gi|257843324 Staphylococcus aureus A9719 NCBI   serine protease SplD
gi|257851235 Staphylococcus aureus A8115 NCBI   serine protease SplD
gi|257853871 Staphylococcus aureus A6300 NCBI   serine protease SplD
gi|257858471 Staphylococcus aureus A6224 NCBI   serine protease SplD
gi|257859673 Staphylococcus aureus A5948 NCBI   serine protease SplD
gi|257863691 Staphylococcus aureus A5937 NCBI   serine proteinase SplD
gi|258420720 Staphylococcus aureus A9719 NCBI   serine protease SplD
gi|258443829 Staphylococcus aureus A8115 NCBI   serine protease SplD
gi|258447284 Staphylococcus aureus A6300 NCBI   serine protease SplD
gi|258448232 Staphylococcus aureus A6224 NCBI   serine protease SplD
gi|258452698 Staphylococcus aureus A5948 NCBI   serine protease SplD
gi|258454239 Staphylococcus aureus A5937 NCBI   serine proteinase SplD
gi|81704836 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|81705483 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine protease splD; Flags: Precursor
gi|87126488 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   serine protease SplD
gi|87160514 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   serine protease SplD
gi|87203191 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   serine protease SplD
gi|88195633 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   serine protease SplD
gi|9739159 Staphylococcus aureus NCBI   serine protease SplD
img|637093294 Staphylococcus aureus aureus N315 IMG   serine protease SplD
img|637100317 Staphylococcus aureus aureus Mu50 IMG   serine protease
img|637888401 Staphylococcus aureus aureus USA300 IMG   serine protease SplD( EC:3.4.21.19 )
img|637894533 Staphylococcus aureus aureus NCTC 8325 IMG   serine protease SplD( EC:3.4.21.19 )
img|640796084 Staphylococcus aureus aureus Newman IMG   serine protease SplD
img|640904539 Staphylococcus aureus aureus Mu3 IMG   serine protease
img|641309760 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   S1B family serine protease SplD( EC:3.4.21.- )
kegg|saa:SAUSA300_1755 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   serine protease SplD (EC:3.4.21.19)
kegg|sae:NWMN_1703 Staphylococcus aureus subsp. aureus Newman KEGG   serine protease SplD
kegg|sao:SAOUHSC_01938 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   serine protease SplD (EC:3.4.21.19)
kegg|sau:SA1628   KEGG   serine protease SplD
kegg|sav:SAV1810   KEGG   serine protease
kegg|saw:SAHV_1795 Staphylococcus aureus subsp. aureus Mu3 KEGG   serine protease
kegg|sax:USA300HOU_1803 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   serine protease SplD (EC:3.4.21.-)
ref|NP_372334.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   serine protease
ref|NP_374917.1 Staphylococcus aureus subsp. aureus N315 RefSeq   serine protease SplD
ref|YP_001332737.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   serine protease SplD
ref|YP_001442385.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   serine protease
ref|YP_001575685.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   serine protease SplD
ref|YP_494446.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   serine protease SplD
ref|YP_500439.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   serine protease SplD
ref|ZP_05145197.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   serine protease SplD
ref|ZP_05642809.1 Staphylococcus aureus A9781 RefSeq   serine protease SplD
ref|ZP_05683659.1 Staphylococcus aureus A9719 RefSeq   serine protease SplD
ref|ZP_05692168.1 Staphylococcus aureus A8115 RefSeq   serine protease SplD
ref|ZP_05695431.1 Staphylococcus aureus A6300 RefSeq   serine protease SplD
ref|ZP_05696359.1 Staphylococcus aureus A6224 RefSeq   serine protease SplD
ref|ZP_05700697.1 Staphylococcus aureus A5948 RefSeq   serine protease SplD
ref|ZP_05702210.1 Staphylococcus aureus A5937 RefSeq   serine proteinase SplD
sp|A6QHZ3 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|A7X3Q6 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|A8Z4N6 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|Q2FFT2 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|Q2FXC5 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|Q7A2Q9 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|Q7A4Y3 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor
sp|SPLD_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine protease splD; Flags: Precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search