The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1892: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: O-succinylbenzoate synthase (EC 4.2.1.113)
Translate Function Assignments



Context on contig NC_007793 from base 1913878 to 1925788 (11911 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1886 1915071 1913878 1194 -       6: 9 14 8 4 16 7   S-adenosylmethionine synthetase (EC 2.5.1.6) gene_name|metK, locus|SAUSA300_1730, protein_id|YP_494422.1, gi|87160443, geneID|3912946
1887 1915442 1917034 1593 + 370     4: 12 15 13 6 dlit(8655523) Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) gene_name|pckA, locus|SAUSA300_1731, protein_id|YP_494423.1, gi|87162156, geneID|3915187
1888 1917319 1917170 150 - 135         Mobile element protein locus|SAUSA300_1732, protein_id|YP_494424.1, gi|87161023, geneID|3913939
1889 1918800 1918030 771 - 710         Dipeptidyl aminopeptidases/acylaminoacyl-peptidases locus|SAUSA300_1733, protein_id|YP_494425.1, gi|87160510, geneID|3914722
1890 1919260 1918781 480 - -20     2: 17 10   Low G+C gram positive nudix hydrolase YtkD (EC 3.6.-.-) locus|SAUSA300_1734, protein_id|YP_494426.1, gi|87161491, geneID|3914233
1891 1919320 1919577 258 + 59     2: 18 11   Membrane protein insertion efficiency factor YidD locus|SAUSA300_1736, protein_id|YP_494427.1, gi|87160573, geneID|3914999
1892 1920575 1919574 1002 - -4     4: 2 5 1 3   O-succinylbenzoate synthase (EC 4.2.1.113) gene_name|menC, locus|SAUSA300_1735, protein_id|YP_494428.1, gi|87162143, geneID|3914690
1893 1922058 1920580 1479 - 4     3: 2 1 3   O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26) gene_name|menE, locus|SAUSA300_1737, protein_id|YP_494429.1, gi|87161579, geneID|3913648
1894 1922699 1922217 483 - 158         Hypothetical protein SAV1798 locus|SAUSA300_1738, protein_id|YP_494430.1, gi|87161784, geneID|3913638
1895 1923011 1923625 615 + 311         Hypothetical protein SAV1799 locus|SAUSA300_1739, protein_id|YP_494431.1, gi|87161148, geneID|3914493
1896 1923706 1924701 996 + 80         Hypothetical protein SAV1800 locus|SAUSA300_1740, protein_id|YP_494432.1, gi|87160435, geneID|3912938
1897 1924777 1924932 156 + 75         Hypothetical protein SAV1801 locus|SAUSA300_1741, protein_id|YP_494433.1, gi|87161836, geneID|3913807
1898 1924933 1925403 471 + 0         Hypothetical protein SAV1801 locus|SAUSA300_1742, protein_id|YP_494434.1, gi|87160056, geneID|3912909
1899 1925444 1925788 345 + 40         Hypothetical protein SAV1802 locus|SAUSA300_1743, protein_id|YP_494435.1, gi|87162068, geneID|3914247

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Muconate_lactonizing_enzyme_family gjo O-succinylbenzoate synthase (EC 4.2.1.113)
Menaquinone_and_Phylloquinone_Biosynthesis OlgaZ O-succinylbenzoate synthase (EC 4.2.1.113)
Quinones_biosynthesis_HGM_New Kutt_Laura_user O-succinylbenzoate-CoA synthase (EC 4.2.1.-)
Menaquinone_biosynthesis_PanGenomes Smajic_Semra_user O-succinylbenzoate synthase (EC 4.2.1.113)


  Protein Sequence

>fig|451515.3.peg.1892 O-succinylbenzoate synthase (EC 4.2.1.113)
MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
FTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVV
VLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
YFEQDVVAHSGILKEGRLEFRPPLVDITQLQPY

MD5 = 12ecdb1c9d3990294d3c293633fc42ae


  DNA Sequence

>fig|451515.3.peg.1892 O-succinylbenzoate synthase (EC 4.2.1.113)
atgaagttgacagctttgcatttttataaatatagtgagccatttaagtcacaaattgta
acaccgaaagtcactttaacgcatcgtgattgtttgtttatcgaattgattgatgacaaa
ggaaatgcatatttcggggaatgtaacgcttttcaaacagattggtatgatcatgaaaca
attgcctcagtgaaacatgtaattgagcaatggttcgaagataatagaaataaatcattt
gaaacgtatgaagcagcactaaaattagtagattcattggaaaatacgcctgctgcaagg
gcaactattgtcatggcattgtatcaaatgtttcatgtactgccttcattttcagtagca
tatggagcgacagcgagcggcttatcaaataaacaactagagtcattaaaagcaacaaag
ccgaccagaattaaattaaaatggacgcctcaaatcatgcatcaaattagagtgttacgg
gaattagactttcactttcaattggttatagatgcaaatgagtccttggatcgtcaagat
ttcacacagttacagttattagcgcgtgaacaggttctttatatcgaagagccatttaaa
gatatctccatgcttgatgaagtagcggatggaacaatacctccaatagcccttgatgaa
aaggcaacatcgttgttggacataattaatttgatagaattatacaatgtgaaagttgtt
gtattaaaaccatttcgtctaggtggcattgataaagtgcaaacggcaattgatactttg
aaaagtcatggtgcaaaagtggttattggcggcatgtacgaatatggtttaagccgctat
tttacagcgatgcttgctcgtaaaggtgattatccaggagatgttacaccagcaggttat
tattttgaacaagatgtggtggcgcattcaggcatattaaaagaggggcgactcgaattt
cgcccccctttagtggatataactcaattacaaccatattaa


  DNA with Flanking Sequence

>fig|451515.3.peg.1892 O-succinylbenzoate synthase (EC 4.2.1.113)
gatgccaagtgccaatgttgacgtaaaaattaaaaatcctaataaagaaggtcatggaga
attaatgattaaaggcgccaatgtgatgaatgtatatttgtatccaacagatttaacggg
tacgtttgaaaatggttattttaatacgggtgacattgctgaaatagatcatgaaggtta
tgtcatgatttatgaccgacgtaaagatttaattattagtggcggtgaaaatatttatcc
atatcaaattgaaacggtagcgaagcaatttccaggtatcagtgacgcagtatgtgtagg
gcatcctgatgatacttggggccaagtgcctaaattatattttgtcagtgaaagtgacat
ttcaaaggcacaattgattgcatatttatcacaacatttagcgaaatataaagtaccgaa
acactttgaaaaggttgatactttaccttatacatcaacaggtaaattacaaagaaataa
gttgtatagaggatgatttgatgaagttgacagctttgcatttttataaatatagtgagc
catttaagtcacaaattgtaacaccgaaagtcactttaacgcatcgtgattgtttgttta
tcgaattgattgatgacaaaggaaatgcatatttcggggaatgtaacgcttttcaaacag
attggtatgatcatgaaacaattgcctcagtgaaacatgtaattgagcaatggttcgaag
ataatagaaataaatcatttgaaacgtatgaagcagcactaaaattagtagattcattgg
aaaatacgcctgctgcaagggcaactattgtcatggcattgtatcaaatgtttcatgtac
tgccttcattttcagtagcatatggagcgacagcgagcggcttatcaaataaacaactag
agtcattaaaagcaacaaagccgaccagaattaaattaaaatggacgcctcaaatcatgc
atcaaattagagtgttacgggaattagactttcactttcaattggttatagatgcaaatg
agtccttggatcgtcaagatttcacacagttacagttattagcgcgtgaacaggttcttt
atatcgaagagccatttaaagatatctccatgcttgatgaagtagcggatggaacaatac
ctccaatagcccttgatgaaaaggcaacatcgttgttggacataattaatttgatagaat
tatacaatgtgaaagttgttgtattaaaaccatttcgtctaggtggcattgataaagtgc
aaacggcaattgatactttgaaaagtcatggtgcaaaagtggttattggcggcatgtacg
aatatggtttaagccgctattttacagcgatgcttgctcgtaaaggtgattatccaggag
atgttacaccagcaggttattattttgaacaagatgtggtggcgcattcaggcatattaa
aagaggggcgactcgaatttcgcccccctttagtggatataactcaattacaaccatatt
aatggttatgtttatgtgaatgcttgcttgctgacttgtctttttttaacggaacagggt
caaagccgcctttatgaagcggatgacattttaaaatacgacggatacctaaataaaggc
ctttgaaagcaccgtggtattgaatcgcttctctagtgtactctgaacatgttggataaa
aacgacaagttggtggagtgagtggcgaaatgaaacgttgataaaaatgaatcatcgcca
agaatatctttttcataattaatgcctccaacgatagtaattaactattatattaacata
caatgtagggatgtgatgcgcgtgaagtttagggataaagataatcgtcaagttaatttg
acatttaaaaaggataatgagatagcagatggcaatcatgtgctagctattccaacgttt
aaaaatcaattgctttttaccaaacataatttacgggggattgaatttcctggtggtaaa
agggaacgcggggaaagtagtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003824       F:catalytic activity
GO:0008152       P:metabolic process
GO:0016829       F:lyase activity
cmr|NT05SA1703 Staphylococcus aureus NCTC 8325     O-succinylbenzoic acid (OSB) synthetase
cmr|SACOL1843 Staphylococcus aureus subsp. aureus COL     o-succinylbenzoic acid (OSB) synthetase, putative
cmr|SAUSA300_1735 Staphylococcus aureus subsp. aureus USA300-FPR3757     O-succinylbenzoic acid synthetase
dbj|BAF67957.1 Staphylococcus aureus subsp. aureus str. Newman     o-succinylbenzoic acid synthetase
fig|367830.3.peg.1380 Staphylococcus aureus subsp. aureus USA300 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|426430.6.peg.1633 Staphylococcus aureus subsp. aureus str. Newman FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|426430.8.peg.1823 Staphylococcus aureus subsp. aureus str. Newman FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|451516.9.peg.1881 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|452948.4.peg.2624 Staphylococcus aureus 930918-3 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|455227.3.peg.2458 Staphylococcus aureus D30 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|546342.3.peg.325 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|546343.3.peg.133 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|553567.3.peg.1396 Staphylococcus aureus A5948 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|553590.4.peg.2711 Staphylococcus aureus A9754 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|553594.3.peg.2777 Staphylococcus aureus A9765 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|644279.4.peg.1937 Staphylococcus aureus subsp. aureus 132 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|93061.3.peg.1808 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|93061.5.peg.1744 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|93062.19.peg.1804 Staphylococcus aureus subsp. aureus COL FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
fig|93062.4.peg.507 Staphylococcus aureus subsp. aureus COL FIG   O-succinylbenzoate synthase (EC 4.2.1.113)
gb|AAA96059.1 organism not parsed/found in ncbi nr     o-succinylbenzoic acid (OSB) synthetase
gb|AAW36861.1 Staphylococcus aureus subsp. aureus COL     o-succinylbenzoic acid (OSB) synthetase, putative
gb|ABD22631.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     O-succinylbenzoic acid synthetase
gb|ABD30978.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29788.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible o-succinylbenzoic acid (OSB) synthetase
gb|EEV83242.1 Staphylococcus aureus A5948     O-succinylbenzoic acid synthetase
gb|EEW43981.1 Staphylococcus aureus 930918-3     o-succinylbenzoic acid synthetase
gb|EEW46193.1 Staphylococcus aureus D30     o-succinylbenzoic acid synthetase
gi|1255260 organism not parsed/found in ncbi nr NCBI   o-succinylbenzoic acid (OSB) synthetase
gi|150374697 Staphylococcus aureus subsp. aureus str. Newman NCBI   o-succinylbenzoic acid synthetase
gi|151221897 Staphylococcus aureus subsp. aureus str. Newman NCBI   o-succinylbenzoic acid synthetase
gi|160368817 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible o-succinylbenzoic acid (OSB) synthetase
gi|161510008 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   o-succinylbenzoic acid (OSB) synthetase
gi|221137336 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   o-succinylbenzoic acid (OSB) synthetase
gi|221140129 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   o-succinylbenzoic acid (OSB) synthetase
gi|257860412 Staphylococcus aureus A5948 NCBI   O-succinylbenzoic acid synthetase
gi|258451902 Staphylococcus aureus A5948 NCBI   O-succinylbenzoic acid synthetase
gi|259158892 Staphylococcus aureus 930918-3 NCBI   o-succinylbenzoic acid synthetase
gi|259161597 Staphylococcus aureus D30 NCBI   o-succinylbenzoic acid synthetase
gi|57284767 Staphylococcus aureus subsp. aureus COL NCBI   o-succinylbenzoic acid (OSB) synthetase, putative
gi|57650581 Staphylococcus aureus subsp. aureus COL NCBI   o-succinylbenzoic acid (OSB) synthetase, putative
gi|87128117 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   O-succinylbenzoic acid synthetase
gi|87162143 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   O-succinylbenzoic acid synthetase
gi|87203168 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195610 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01915
img|637152574 Staphylococcus aureus aureus COL IMG   o-succinylbenzoic acid (OSB) synthetase, putative
img|637888383 Staphylococcus aureus aureus USA300 IMG   O-succinylbenzoic acid synthetase( EC:4.2.1.- )
img|637894510 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796066 Staphylococcus aureus aureus Newman IMG   o-succinylbenzoic acid synthetase
img|641309741 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible o-succinylbenzoic acid (OSB) synthetase
img|641770989 Staphylococcus aureus aureus USA300_TCH959 IMG   possible o-succinylbenzoic acid (OSB) synthetase
kegg|saa:SAUSA300_1735 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   O-succinylbenzoic acid synthetase (EC:4.2.1.-)
kegg|sac:SACOL1843 Staphylococcus aureus subsp. aureus COL KEGG   O-succinylbenzoic acid (OSB) synthetase, putative
kegg|sae:NWMN_1685 Staphylococcus aureus subsp. aureus Newman KEGG   O-succinylbenzoic acid synthetase
kegg|sao:SAOUHSC_01915 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1783 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   O-succinylbenzoic acid (OSB) synthetase
ref|YP_001332719.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   o-succinylbenzoic acid synthetase
ref|YP_001575667.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   o-succinylbenzoic acid (OSB) synthetase
ref|YP_186674.1 Staphylococcus aureus subsp. aureus COL RefSeq   o-succinylbenzoic acid (OSB) synthetase, putative
ref|YP_494428.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   O-succinylbenzoic acid synthetase
ref|YP_500416.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01915
ref|ZP_03562145.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   o-succinylbenzoic acid (OSB) synthetase
ref|ZP_03564622.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   o-succinylbenzoic acid (OSB) synthetase
ref|ZP_05699920.1 Staphylococcus aureus A5948 RefSeq   O-succinylbenzoic acid synthetase
tr|A6QHX5 Staphylococcus aureus (strain Newman) TrEMBL   O-succinylbenzoic acid synthetase
tr|A8Z4L8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible o-succinylbenzoic acid (OSB) synthetase
tr|Q2FFV0 Staphylococcus aureus (strain USA300) TrEMBL   O-succinylbenzoic acid synthetase
tr|Q2G2V2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q53635 Staphylococcus aureus TrEMBL   O-succinylbenzoic acid (OSB) synthetase
tr|Q5HEY3 Staphylococcus aureus (strain COL) TrEMBL   O-succinylbenzoic acid (OSB) synthetase, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search