The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.185: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
Translate Function Assignments



Context on contig NC_007793 from base 144917 to 156826 (11910 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
178 144917 145681 765 +       1: 3 dlit(14688077) L-serine kinase (ATP) (EC 2.7.1.225) locus|SAUSA300_0126, protein_id|YP_492843.1, gi|87161161, geneID|3914506
179 145871 146284 414 + 189         FIG01107877: hypothetical protein locus|SAUSA300_0127, protein_id|YP_492844.1, gi|87161743, geneID|3913029
180 146334 146960 627 + 49         FIG01108113: hypothetical protein locus|SAUSA300_0128, protein_id|YP_492845.1, gi|87160739, geneID|3913440
181 147172 147948 777 + 211     1: 2   2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) @ Diacetyl reductase [(S)-acetoin forming] (EC 1.1.1.304) locus|SAUSA300_0129, protein_id|YP_492846.1, gi|87162164, geneID|3915195
182 148149 147997 153 - 48         FIG01108063: hypothetical protein  
183 148293 149264 972 + 143         UDP-glucose 4-epimerase (EC 5.1.3.2) locus|SAUSA300_0130, protein_id|YP_492847.1, gi|87162155, geneID|3915186
184 149227 149919 693 + -38         Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase; teichuronic acid biosynthesis glycosyltransferase TuaA locus|SAUSA300_0131, protein_id|YP_492848.1, gi|87160450, geneID|3912953
185 150129 151295 1167 + 209     1: 11   Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-) locus|SAUSA300_0132, protein_id|YP_492849.1, gi|87161056, geneID|3912766
186 151276 152514 1239 + -20         Teichuronic acid biosynthesis protein TuaE, putative secreted polysaccharide polymerase locus|SAUSA300_0133, protein_id|YP_492850.1, gi|87161321, geneID|3915292
187 152504 153934 1431 + -11     1: 7   Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids locus|SAUSA300_0134, protein_id|YP_492851.1, gi|87161267, geneID|3915238
188 154202 154801 600 + 267     6: 8 9 5 10 6 4 dlit(7557308)
dlit(11948161)
dlit(14523108)
Superoxide dismutase [Mn] (EC 1.15.1.1); Superoxide dismutase [Fe] (EC 1.15.1.1) locus|SAUSA300_0135, protein_id|YP_492852.1, gi|87161851, geneID|3913957
189 155169 155894 726 + 367     1: 1   Predicted cell-wall-anchored protein SasD (LPXAG motif) locus|SAUSA300_0136, protein_id|YP_492853.1, gi|87160939, geneID|3913779
190 156826 156086 741 - 191         Predicted regulator for deoxynucleoside utilization, GntR family locus|SAUSA300_0137, protein_id|YP_492854.1, gi|87162100, geneID|3913094

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Exopolysaccharide_Biosynthesis OlgaZ Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)


  Protein Sequence

>fig|451515.3.peg.185 Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
MKIIYCITKADNGGAQTHLIQLANHFCVHNDVYVIVGNHGPMIEQLDARVNVIIIEHLVG
PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRIVFTAHGWAF
TEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
NSNHAHFTFIGDGPTLNDCQQQVVQAGLENEVTFLGNVINASHLLSQYDTFILISKHEGL
PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
SRKRYLECFTEEKMIKEVEDVYNGKSTQ

MD5 = e507d10f400c83262d78ccc5f3b0f304


  DNA Sequence

>fig|451515.3.peg.185 Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
ttgaaaattatatattgtattactaaagcagacaatggtggtgcacaaacacatctcatt
caactcgccaaccatttttgcgtacacaatgatgtttatgtcattgtaggcaatcatgga
ccaatgattgaacaactagatgcaagagttaatgtaattattatcgaacatttagtaggt
ccaattgactttaaacaagatattttagctgtcaaagtgttagcacagttattctcgaaa
attaaacctgatgttatccatttacattcttccaaagctggaacggtcggacgaattgcg
aagttcatttcgaaatcgaaagacacacgtatagtttttactgcacatggatgggctttt
acagagggtgttaaaccagctaaaaaatttctatatttagttatcgaaaaattaatgtca
cttattacagatagcattatttgtgtttcagatttcgataaacagttagcgttaaaatat
cgatttaatcgattgaaattaaccacaatacataatggtattgcagatgttcccgctgtt
aagcaaacgctaaaaagccaatcacataacaatattggcgaagtagttggaatgttgcct
aataaacaagatttacagattaatgccccgacaaagcatcaatttgttatgattgcaaga
tttgcttatccaaaattgccacaaaatctaatcgcggcaatagagatattgaaattacat
aacagtaatcatgcgcattttacatttataggcgatggacctacattaaatgattgtcag
caacaagttgtacaagctgggttagaaaatgaagtcacatttttgggcaatgtcattaat
gcgagtcatttattatcacaatacgatacgtttattttaataagtaagcatgaaggtttg
ccaattagcattatagaagctatggctacaggtttgcctgttatagccagtcatgttggc
ggtatttcagaattagtagctgataatggtatatgtatgatgaacaaccaacccgaaact
attgctaaagtcctggaaaaatatttaatagacagtgattacatcaaaatgagtaatcaa
tctagaaaacgttatttagaatgttttactgaggagaaaatgattaaagaagtggaagac
gtttataatggaaaatcaacacaatag


  DNA with Flanking Sequence

>fig|451515.3.peg.185 Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
ttaccacaactaattaatgttgttaaaggggaaatgagttttattggaccacgcccggaa
cgtccggaatttgtagaattatttagttcagaagtgataggtttcgagcaaagatgtctt
gttacaccagggttaacaggacttgcgcaaattcaaggtggatatgacttaacaccgcaa
caaaaactgaaatatgacatgaaatatatacataaaggtagtttaatgatggaactatat
atatcaattagaacattgatggttgttattacaggggaaggctcaaggtagtcttaattt
acttaataagttcaaataaaagttatattttaaagattgtgaccaattgttacagtataa
cgaggaatcccttgagacagtatcaaatggcattaagaaatatgtgccatcattgatttg
catggctataaatactattcatctgatgagatagccatgttaagaaattgaaagtatagc
attaaaggggtttgtaacagttgaaaattatatattgtattactaaagcagacaatggtg
gtgcacaaacacatctcattcaactcgccaaccatttttgcgtacacaatgatgtttatg
tcattgtaggcaatcatggaccaatgattgaacaactagatgcaagagttaatgtaatta
ttatcgaacatttagtaggtccaattgactttaaacaagatattttagctgtcaaagtgt
tagcacagttattctcgaaaattaaacctgatgttatccatttacattcttccaaagctg
gaacggtcggacgaattgcgaagttcatttcgaaatcgaaagacacacgtatagttttta
ctgcacatggatgggcttttacagagggtgttaaaccagctaaaaaatttctatatttag
ttatcgaaaaattaatgtcacttattacagatagcattatttgtgtttcagatttcgata
aacagttagcgttaaaatatcgatttaatcgattgaaattaaccacaatacataatggta
ttgcagatgttcccgctgttaagcaaacgctaaaaagccaatcacataacaatattggcg
aagtagttggaatgttgcctaataaacaagatttacagattaatgccccgacaaagcatc
aatttgttatgattgcaagatttgcttatccaaaattgccacaaaatctaatcgcggcaa
tagagatattgaaattacataacagtaatcatgcgcattttacatttataggcgatggac
ctacattaaatgattgtcagcaacaagttgtacaagctgggttagaaaatgaagtcacat
ttttgggcaatgtcattaatgcgagtcatttattatcacaatacgatacgtttattttaa
taagtaagcatgaaggtttgccaattagcattatagaagctatggctacaggtttgcctg
ttatagccagtcatgttggcggtatttcagaattagtagctgataatggtatatgtatga
tgaacaaccaacccgaaactattgctaaagtcctggaaaaatatttaatagacagtgatt
acatcaaaatgagtaatcaatctagaaaacgttatttagaatgttttactgaggagaaaa
tgattaaagaagtggaagacgtttataatggaaaatcaacacaatagtaaattactaaca
ttgttacttatcggtttagcggtttttattcagcaatcttcggttattgccggtgtgaat
gtttctatagctgactttatcacattactaatattagtttatttactgtttttcgctaac
catttattaaaggcaaatcattttttacagtttttcattattttgtatacatatcgtatg
attattacgctttgtttgctattttttgatgatttgatatttattacggttaaggaagtt
cttgcatctacagttaaatatgcatttgtagtcatttatttctatttagggatgatcatc
tttaagttaggtaatagcaaaaaagtgatcgttacctcttatattataagcagtgtgact
ataggtctattttgtattatagctggtttgaacaagtcccctttactaatgaaattgtta
tattttgatgaaatacgttcaaaaggattaatgaatgaccctaactatttcgcgatgaca
cagatta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0009058       P:biosynthetic process
GO:0016740       F:transferase activity
GO:0016757       F:transferase activity, transferring glycosyl...
cmr|SAUSA300_0132 Staphylococcus aureus subsp. aureus USA300-FPR3757     glycosyl transferase, group 1 family protein
fig|367830.3.peg.1088 Staphylococcus aureus subsp. aureus USA300 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
fig|451516.9.peg.173 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
fig|553590.4.peg.1128 Staphylococcus aureus A9754 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)
gb|ABD21544.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     glycosyl transferase, group 1 family protein
gb|ABX28179.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glycosyltransferase
gi|160367208 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycosyltransferase
gi|161508399 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycosyltransferase
gi|87127030 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycosyl transferase, group 1 family protein
gi|87161056 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycosyl transferase, group 1 family protein
img|637886790 Staphylococcus aureus aureus USA300 IMG   glycosyl transferase, group 1 family protein
img|641308107 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glycosyltransferase( EC:2.4.1.- )
kegg|saa:SAUSA300_0132 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   glycosyl transferase, group 1 family protein
kegg|sax:USA300HOU_0142 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glycosyltransferase (EC:2.4.1.-)
ref|YP_001574058.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glycosyltransferase
ref|YP_492849.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   glycosyl transferase, group 1 family protein
tr|A8YZ56 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Glycosyltransferase
tr|Q2FKC9 Staphylococcus aureus (strain USA300) TrEMBL   Glycosyl transferase, group 1 family protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search