The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1727: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: sigmaB-controlled gene product
Translate Function Assignments



Context on contig NC_007793 from base 1727508 to 1737871 (10364 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1722 1728176 1727508 669 -           Tetratricopeptide repeat (TPR) family protein locus|SAUSA300_1577, protein_id|YP_494272.1, gi|87162270, geneID|3913188
1723 1729756 1728638 1119 - 461     1: 12   tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) gene_name|mnmA, locus|SAUSA300_1578, protein_id|YP_494273.1, gi|87162110, geneID|3913104
1724 1730899 1729757 1143 - 0     10: 10 1 5 13 2 17 9 7 14 16   Cysteine desulfurase (EC 2.8.1.7) => YrvO ## donor for tRNA 2-thiouridine(34) synthesis locus|SAUSA300_1579, protein_id|YP_494274.1, gi|87162404, geneID|3913927
1725 1731211 1732224 1014 + 311         Flavin-utilizing monoxygenase locus|SAUSA300_1580, protein_id|YP_494275.1, gi|87160678, geneID|3915055
1726 1732607 1732461 147 - 236         FIG01108208: hypothetical protein locus|SAUSA300_1581, protein_id|YP_494276.1, gi|87160135, geneID|3912988
1727 1732829 1732647 183 - 39         sigmaB-controlled gene product locus|SAUSA300_1582, protein_id|YP_494277.1, gi|87162159, geneID|3915190
1728 1733351 1732929 423 - 99     2: 3 6   Iron-sulfur cluster regulator IscR locus|SAUSA300_1583, protein_id|YP_494278.1, gi|87161573, geneID|3913642
1729 1733436 1734710 1275 + 84     1: 1   Uncharacterized ATPase (AAA family) associated with cysteine desulfurase locus|SAUSA300_1584, protein_id|YP_494279.2, gi|162138568, geneID|3914522
1730 1735644 1734871 774 - 160     2: 8 15   tRNA threonylcarbamoyladenosine dehydratase locus|SAUSA300_1585, protein_id|YP_494280.1, gi|87161263, geneID|3915234
1731 1736016 1735858 159 - 213         Doubtful CDS. No database matches  
1732 1737871 1736105 1767 - 88     2: 4 11   Aspartyl-tRNA synthetase (EC 6.1.1.12) gene_name|aspS, locus|SAUSA300_1586, protein_id|YP_494281.1, gi|87160735, geneID|3913436

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.1727 sigmaB-controlled gene product
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK

MD5 = 68a716f8a773740042af89f66e79ba11


  DNA Sequence

>fig|451515.3.peg.1727 sigmaB-controlled gene product
atggcagacgaaagtaagttcgatcaatttaaaggaaatgttaaagaaacagtaggtaac
gttactgataacaaagaattagaaaaagaaggtcagcaagataaagtgattggtaaagca
aaagaagttgttgaaaatgctaaaaacaaaataactgatgcaattgataaacttaaaaaa
taa


  DNA with Flanking Sequence

>fig|451515.3.peg.1727 sigmaB-controlled gene product
gatatggacttacattgatgatttctcttgctaaaaaagaggggcaaggatgtatatcat
taaagtcaattgctgaagaaaataatttgagtgatttatatttagaacagcttgtaggtc
ctttaagaaatgcggggttaattcgaagtgtacgcggtgctaaaggtggataccaattaa
gagtgccagcggaagaaatctcagcaggggatattataagactgttagaaggtccaatta
catttgttgaaagtattgaatcagaaccacctgcgcaaaaacaactatggattcgcatga
gagatgcagtgagagatgttttagataatacaacattgaaatatttagcggaatatgtag
atacaagtgaagatttagacggatacatgttttatatttaatcgtataaatactatacta
taacataaaaacttcatattataatgtttagcgaacctccttagtggtatataaatatat
acatccaaggaggtttcactatggcagacgaaagtaagttcgatcaatttaaaggaaatg
ttaaagaaacagtaggtaacgttactgataacaaagaattagaaaaagaaggtcagcaag
ataaagtgattggtaaagcaaaagaagttgttgaaaatgctaaaaacaaaataactgatg
caattgataaacttaaaaaataagttcaattaaactaatcaaatataagaggagcgatta
atatgagttttatggataaagctaaagacgcagtagaaaaatttaaaaatagcgataatg
aacaagttaaaaatgtaaaagataagataaatgaatatacaggatcgaataacgaagaga
aaaaagaaaatgaagataaagagaaataaatttctttaaattttggatatgcttttcaat
attttgaaagcgccccatcaaataaacacttacacagtgtaaagttgaaggggcgctttc
atatttgcattagaattttaagtgaatttgaatcattactaaaataaatgattgaacaat
aaagacatctttcattcaaaatgctgttactgtatatttttattaatattatggatacat
actttcacttagtttatttatcacattataaagtgtttttttcatttatctgatttataa
cattcttgaaccgacgataagagtctaattgcatatctttatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL1680 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1582 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF67799.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.396 Staphylococcus aureus subsp. aureus USA300 FIG   sigmaB-controlled gene product
fig|426430.6.peg.1481 Staphylococcus aureus subsp. aureus str. Newman FIG   sigmaB-controlled gene product
fig|426430.8.peg.1656 Staphylococcus aureus subsp. aureus str. Newman FIG   sigmaB-controlled gene product
fig|451516.9.peg.1716 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   sigmaB-controlled gene product
fig|452948.4.peg.151 Staphylococcus aureus 930918-3 FIG   sigmaB-controlled gene product
fig|455227.3.peg.575 Staphylococcus aureus D30 FIG   sigmaB-controlled gene product
fig|546342.3.peg.2070 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   sigmaB-controlled gene product
fig|546343.3.peg.1129 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   sigmaB-controlled gene product
fig|553567.3.peg.36 Staphylococcus aureus A5948 FIG   sigmaB-controlled gene product
fig|553590.4.peg.714 Staphylococcus aureus A9754 FIG   sigmaB-controlled gene product
fig|553594.3.peg.250 Staphylococcus aureus A9765 FIG   sigmaB-controlled gene product
fig|644279.4.peg.1777 Staphylococcus aureus subsp. aureus 132 FIG   sigmaB-controlled gene product
fig|93062.19.peg.1637 Staphylococcus aureus subsp. aureus COL FIG   sigmaB-controlled gene product
fig|93062.4.peg.1862 Staphylococcus aureus subsp. aureus COL FIG   sigmaB-controlled gene product
gb|AAW36787.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22647.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABX29632.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1625
gb|EEV84505.1 Staphylococcus aureus A5948     sigmaB-controlled protein
gi|123485537 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0337 protein SAUSA300_1582
gi|150374539 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221739 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1527
gi|160368661 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1625
gi|161509852 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1625
gi|221139027 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_10365
gi|221141105 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_05633
gi|257861706 Staphylococcus aureus A5948 NCBI   sigmaB-controlled protein
gi|258450548 Staphylococcus aureus A5948 NCBI   sigmaB-controlled protein
gi|57284693 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650507 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1680
gi|81694347 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0337 protein SACOL1680
gi|87128133 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162159 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1582
img|637152420 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888232 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|640795908 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309584 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|saa:SAUSA300_1582 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1680 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1527 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sax:USA300HOU_1625 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001332561.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1527
ref|YP_001575511.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1625
ref|YP_186520.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1680
ref|YP_494277.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1582
ref|ZP_03563827.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_10365
ref|ZP_03565598.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_05633
ref|ZP_05698610.1 Staphylococcus aureus A5948 RefSeq   sigmaB-controlled protein
sp|Q2FGA1 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=UPF0337 protein SAUSA300_1582
sp|Q5HFD7 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0337 protein SACOL1680
sp|Y1582_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0337 protein SAUSA300_1582
sp|Y1680_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0337 protein SACOL1680
tr|A6QHG7 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z4G3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search