The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1447: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: PBS lyase HEAT-like repeat domain protein
Translate Function Assignments



Context on contig NC_007793 from base 1448103 to 1488076 (39974 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1439 1448324 1448103 222 -           UPF0346 protein YozE locus|SAUSA300_1314, protein_id|YP_494011.1, gi|87161711, geneID|3915277
1440 1448824 1448324 501 - -1         PTS system, glucose-specific IIA component gene_name|crr, locus|SAUSA300_1315, protein_id|YP_494012.1, gi|87162382, geneID|3913535
1441 1449264 1448836 429 - 11     1: 2   Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) gene_name|msrB, locus|SAUSA300_1316, protein_id|YP_494013.1, gi|87161086, geneID|3914272
1442 1449790 1449257 534 - -8     1: 2   Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) gene_name|msrA, locus|SAUSA300_1317, protein_id|YP_494014.1, gi|87160485, geneID|3913340
1443 1450715 1449876 840 - 85         Hypothetical protein DUF194, DegV family locus|SAUSA300_1318, protein_id|YP_494015.1, gi|87162066, geneID|3914245
1444 1451209 1450730 480 - 14     6: 4 1 5 9 18 3 dlit(8363365)
dlit(3060373)
Dihydrofolate reductase (EC 1.5.1.3) gene_name|folA, locus|SAUSA300_1319, protein_id|YP_494016.1, gi|87161702, geneID|3914467
1445 1452365 1451409 957 - 199     8: 7 4 1 6 17 23 3 11 dlit(21253898) Thymidylate synthase (EC 2.1.1.45) gene_name|thyA, locus|SAUSA300_1320, protein_id|YP_494017.1, gi|87160328, geneID|3915403
1446 1453226 1452789 438 - 423         UPF0403 protein YphP locus|SAUSA300_1321, protein_id|YP_494018.1, gi|87160533, geneID|3914013
1447 1454366 1453242 1125 - 15       PBS lyase HEAT-like repeat domain protein locus|SAUSA300_1322, protein_id|YP_494019.1, gi|87161495, geneID|3913208
1448 1454655 1454404 252 - 37 5     FIG01108403: hypothetical protein locus|SAUSA300_1323, protein_id|YP_494020.1, gi|87162375, geneID|3913528
1449 1454888 1454667 222 - 11         FIG01108567: hypothetical protein  
1450 1455106 1455810 705 + 217     14: 24 15 19 25 26 8 14 12 16 10 21 22 20 13   Putative preQ0 transporter locus|SAUSA300_1324, protein_id|YP_494021.1, gi|87160540, geneID|3914020
1451 1456006 1455875 132 - 64         FIG01108060: hypothetical protein locus|SAUSA300_1325, protein_id|YP_494022.1, gi|87160895, geneID|3912972
1452 1456051 1456167 117 + 44         hypothetical protein  
1453 1456351 1456752 402 + 183         RNase H locus|SAUSA300_1326, protein_id|YP_494023.1, gi|87161806, geneID|3914642
1454 1488076 1456811 31266 - 58         Putative Staphylococcal surface anchored protein locus|SAUSA300_1327, protein_id|YP_494024.1, gi|87161956, geneID|3913713

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|451515.3.peg.1447 PBS lyase HEAT-like repeat domain protein
MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIQEVMDGVLEEVLTTY
PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPVVRRTAGDCISDLGYPEALP
EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
ALGSVWKQMANRTI

MD5 = a1b34c2eb994afd16e226cc664a1f01b


  DNA Sequence

>fig|451515.3.peg.1447 PBS lyase HEAT-like repeat domain protein
atggaaattttacgtatagagccaacaccaagtccaaatacaatgaaagttgttttgtca
tatacaagagaagacaagttatctaatacttataaaaaagtagaagaaacacaaccaaga
tttataaatcagttgttatctatagatggtatcacttccatttttcatgtcatgaacttc
ttagctgttgataaggcaccaaaagctgattgggaagtcatattacctgatattaaagct
gctttttctgatgcgaataaggttttagaatctgtaaatgaacctcaaattgacaatcat
tttggtgaaattaaagctgaattattaacttttaagggtataccgtatcaaattaagcta
acttctgctgaccaagaattaagagaacaattaccacaaacatatgttgaccatatgact
caagcgcaaacagcacatgacaatattgtttttatgcgtaaatggctagatttaggaaat
cgctatggaaatattcaagaagtaatggatggtgtcctagaagaagtgctaactacctat
ccagaatcacagttacccgtattggtaaaacatgctttagaagaaaatcacgcaactaat
aattatcatttctatcgacatgtctctttggatgaatatcatgcaactgataattggaag
actcgattacgaatgttaaaccattttccaaagccgacttttgaagatataccgctgctt
gatttagctttatctgatgaaaaagtaccggttagacgtcaagcgattgtattattaggt
atgattgaaagtaaagaaattttaccgtatttatataaggggcttcgtgataaaagtcct
gttgtaagaagaacagcaggggattgcataagcgatttagggtatccagaggcactacca
gaaatggtgctactattagatgatccacagaaaatcgttaggtggcgtgctgctatgttt
atctttgatgaaggtaatgcagagcagcttcccgcactaaaagcccatattaatgacaat
gcgtttgaagttaaattacaaattgaaatggccatatctcgtattgaaaacggagatgaa
gcacttggttcagtatggaaacaaatggcaaacagaacaatttaa


  DNA with Flanking Sequence

>fig|451515.3.peg.1447 PBS lyase HEAT-like repeat domain protein
aggaagtgtcgcgtattttaactttttcagagcaaaatgcactcgcgaaaatagatgatt
taatgaatacttattgcaatcaatgtccaatcaaaactcgtctgcgtaaattagagggga
aaacgaaggcgcatcatttttgtatcaatgagtgttcaatagggaaagaaataaaacaat
taggaaatgaacttcaataggaggaagtcaaatgaaaattatatctatatcagaaacacc
gaaccacaacacaatgaagattacacttagtgaaagcagagaaggtatgacatcagatac
gtatactaaagttgatgattcacagccagcatttattaatgacatcttaaaggttgaagg
cgttaaatcaattttccatgttatggactttatttcagtagataaagaaaatgacgcaaa
ttgggaaacagtattgccaaaagtagaggctgtattcgaataaatttttcatcaactagt
attcggggggaataaagtatatggaaattttacgtatagagccaacaccaagtccaaata
caatgaaagttgttttgtcatatacaagagaagacaagttatctaatacttataaaaaag
tagaagaaacacaaccaagatttataaatcagttgttatctatagatggtatcacttcca
tttttcatgtcatgaacttcttagctgttgataaggcaccaaaagctgattgggaagtca
tattacctgatattaaagctgctttttctgatgcgaataaggttttagaatctgtaaatg
aacctcaaattgacaatcattttggtgaaattaaagctgaattattaacttttaagggta
taccgtatcaaattaagctaacttctgctgaccaagaattaagagaacaattaccacaaa
catatgttgaccatatgactcaagcgcaaacagcacatgacaatattgtttttatgcgta
aatggctagatttaggaaatcgctatggaaatattcaagaagtaatggatggtgtcctag
aagaagtgctaactacctatccagaatcacagttacccgtattggtaaaacatgctttag
aagaaaatcacgcaactaataattatcatttctatcgacatgtctctttggatgaatatc
atgcaactgataattggaagactcgattacgaatgttaaaccattttccaaagccgactt
ttgaagatataccgctgcttgatttagctttatctgatgaaaaagtaccggttagacgtc
aagcgattgtattattaggtatgattgaaagtaaagaaattttaccgtatttatataagg
ggcttcgtgataaaagtcctgttgtaagaagaacagcaggggattgcataagcgatttag
ggtatccagaggcactaccagaaatggtgctactattagatgatccacagaaaatcgtta
ggtggcgtgctgctatgtttatctttgatgaaggtaatgcagagcagcttcccgcactaa
aagcccatattaatgacaatgcgtttgaagttaaattacaaattgaaatggccatatctc
gtattgaaaacggagatgaagcacttggttcagtatggaaacaaatggcaaacagaacaa
tttaattggaggaattaaatatgaatgcatatgatgcttatatgaaagaaattgcgcaac
aaatgcgtggcgaattaactcaaaatggttttacaagtttagaaacgagcgaagcagtat
cggagtatatgaaccaagtaaatgctgatgacactacttttgtagttattaactctacat
gcggctgtgcagctggattagcaagaccagctgcagtagcagttgcaacacaaaatgaac
atagacctacaaatacagttacagtttttgctgggcaagataaagaagcaactgctacaa
tgcgagaattcattcagcaagcaccatctagtccttcgtatgctttattcaaaggtcaag
atttagtttattttatgcctagagaatttatcgaaggtagagatattaatgacattgcaa
tggacttaaaggatgcctttgacgaaaattgtaaatagtacacataaataaatataaagg
ttaacacattttataatattaaaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005506       F:iron ion binding
GO:0009405       P:pathogenesis
cmr|SAUSA300_1322 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
fig|367830.3.peg.1544 Staphylococcus aureus subsp. aureus USA300 FIG   PBS lyase HEAT-like repeat domain protein
fig|451516.9.peg.1452 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   PBS lyase HEAT-like repeat domain protein
fig|553590.4.peg.2794 Staphylococcus aureus A9754 FIG   PBS lyase HEAT-like repeat domain protein
gb|ABD21983.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABX29376.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1366
gi|123735984 organism not parsed/found in ncbi nr NCBI   RecName: Full=Conserved virulence factor C
gi|160368405 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1366
gi|161509596 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1366
gi|87127469 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161495 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1322
img|637887974 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|641309327 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|saa:SAUSA300_1322 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sax:USA300HOU_1366 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001575255.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1366
ref|YP_494019.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1322
sp|CVFC_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Conserved virulence factor C
sp|Q2FH09 Staphylococcus aureus (strain USA300) SwissProt   Conserved virulence factor C
tr|A8Z408 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|451515.3.peg.1448 FIG01108403: hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search