The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.135: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: Disulfide bond regulator
Translate Function Assignments



Context on contig NC_007793 from base 86055 to 99264 (13210 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
129 86055 88118 2064 +       6: 7 5 8 3 4 6   Cu+ P-type ATPase #(EC 3.6.3.4);(TC# 3.A.3.5.2) gene_name|copA, locus|SAUSA300_0078, protein_id|YP_492796.1, gi|87161242, geneID|3914796
130 88136 88681 546 + 17         DUF1541 domain-containing protein locus|SAUSA300_0079, protein_id|YP_492797.1, gi|87160733, geneID|3913434
131 89446 91197 1752 + 764         hypothetical protein locus|SAUSA300_0081, protein_id|YP_492799.1, gi|87161877, geneID|3914565
132 91743 91291 453 - 93     1: 2   tRNA dihydrouridine synthase B (EC 1.-.-.-) locus|SAUSA300_0082, protein_id|YP_492800.1, gi|87160657, geneID|3913981
133 92713 91958 756 - 214     1: 1   UPF0721 transmembrane protein YrkJ locus|SAUSA300_0083, protein_id|YP_492801.1, gi|87160645, geneID|3913969
134 92973 92713 261 - -1     1: 1   FIG007303: uncharacterized protein locus|SAUSA300_0084, protein_id|YP_492802.1, gi|87159958, geneID|3913845
135 93110 94177 1068 + 136     1: 1   Disulfide bond regulator locus|SAUSA300_0085, protein_id|YP_492803.1, gi|87162131, geneID|3913595
136 94208 95542 1335 + 30     1: 1   Zn-dependent hydroxyacylglutathione hydrolase / Polysulfide binding protein locus|SAUSA300_0086, protein_id|YP_492804.1, gi|87160960, geneID|3915355
137 95561 95815 255 + 18     1: 1   FIG002984: FAD-dependent pyridine nucleotide-disulphide oxidoreductase  
138 96065 96754 690 + 249     1: 1   FIG002984: FAD-dependent pyridine nucleotide-disulphide oxidoreductase  
139 97122 97021 102 - 266         Conserved domain protein locus|SAUSA300_0088, protein_id|YP_492805.1, gi|87160921, geneID|3914359
140 98407 97421 987 - 298     1: 2   tRNA-dihydrouridine synthase DusB2 locus|SAUSA300_0089, protein_id|YP_492806.1, gi|87161344, geneID|3912861
141 98716 98919 204 + 308         FIG01108234: hypothetical protein  
142 98968 99264 297 + 48         FIG01108183: hypothetical protein locus|SAUSA300_0090, protein_id|YP_492807.1, gi|87161874, geneID|3914562

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Disulphide_related_cluster Disulfide bond regulator


  Protein Sequence

>fig|451515.3.peg.135 Disulfide bond regulator
MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI

MD5 = 6d33586c3c1138f0c89291f37f15f687


  DNA Sequence

>fig|451515.3.peg.135 Disulfide bond regulator
atgaaacaatacggagaaaagtttatcgatgaatttagtaaagcagaattggaaaaacta
gccaagcaagggcaattaattgacgttagaacagaagaggagtatgcattaggacatatc
aatggttccatacttcatcctgttgatgagattgagtcattcaataaagaaaaaaataaa
acctattatgtaatctgtagaagtggtaacagaagtgctaatgctagtaaatatttagct
aaacaaggttataacgttataaatcttgatggtggttataaagcttatgaagaagaaaac
gatagttatgatacacaagaagaatataaaagtatagaaattaaagcagatcgtaaacaa
tttaactatcgtggtcttcaatgtccagggccaattgtaaaaattagtcaagaaatgaag
aatattgaagtaggtgaccaaattgaagtcaaagtcacagaccctggattccctagtgac
attaaaagttgggtgaaacaaacaaggcatactttagttaagcttgatgaaaataacaat
ggaattaatgcgattattcaaaaagaaaaagcaaaagatttagatataaattattctgct
aaaggtactacaattgtattatttagtggagaattagacaaagctgtagcagcgttgatt
attgcaaatggtgctagagctgctggaaaagatgtaactatcttctttactttttggggg
cttaatgcattaaaaaaagtgcaaacagttaatgttaaaaagcaaggtattgcaaaaatg
tttgatttaatgttgcccaaaaagaatatacgaatgcctctttccaaaatgaatatgttt
ggtttaggaaatatgatgatgcgctacgtaatgaaaaagaaaaatgttgattcattacca
acacttatcaatcaagctattgagcaaaatatcaaattaatcgcttgtacgatgagtatg
gatgtcatgggtattcagaaagaagaacttagagatgaagttgagtacggtggtgtaggc
acttatattggtgctactgaaaatgcgaatcataatttatttatctaa


  DNA with Flanking Sequence

>fig|451515.3.peg.135 Disulfide bond regulator
atagctggataaataatgatagcaccacctacgcctactagaccagatatgaacccaccg
aataccccaatgagtaacatgataactatattaacaatatccattacttacttttcacca
ataagtttacagcttcattaattaactcttgggagctttcttcatcatccgcagctgctt
ttacacattctattaaattctcactaataatgatacccatcaagcgttggagtgaactct
ttgatgcacttatttgtgtaatgacatctttacagtcttttccttcctccatcattttaa
taattccatttagttgcccttgtattctattaatacgattaatcatttttttatcataat
tcatagtcatacctccacttttaattgaataaaaatatattaatagataaacacaaatgt
gtcaaatacccctagaggtatttgacaagttccatccaactgtttaaaatacccctacag
gtatttttagggaggttattatgaaacaatacggagaaaagtttatcgatgaatttagta
aagcagaattggaaaaactagccaagcaagggcaattaattgacgttagaacagaagagg
agtatgcattaggacatatcaatggttccatacttcatcctgttgatgagattgagtcat
tcaataaagaaaaaaataaaacctattatgtaatctgtagaagtggtaacagaagtgcta
atgctagtaaatatttagctaaacaaggttataacgttataaatcttgatggtggttata
aagcttatgaagaagaaaacgatagttatgatacacaagaagaatataaaagtatagaaa
ttaaagcagatcgtaaacaatttaactatcgtggtcttcaatgtccagggccaattgtaa
aaattagtcaagaaatgaagaatattgaagtaggtgaccaaattgaagtcaaagtcacag
accctggattccctagtgacattaaaagttgggtgaaacaaacaaggcatactttagtta
agcttgatgaaaataacaatggaattaatgcgattattcaaaaagaaaaagcaaaagatt
tagatataaattattctgctaaaggtactacaattgtattatttagtggagaattagaca
aagctgtagcagcgttgattattgcaaatggtgctagagctgctggaaaagatgtaacta
tcttctttactttttgggggcttaatgcattaaaaaaagtgcaaacagttaatgttaaaa
agcaaggtattgcaaaaatgtttgatttaatgttgcccaaaaagaatatacgaatgcctc
tttccaaaatgaatatgtttggtttaggaaatatgatgatgcgctacgtaatgaaaaaga
aaaatgttgattcattaccaacacttatcaatcaagctattgagcaaaatatcaaattaa
tcgcttgtacgatgagtatggatgtcatgggtattcagaaagaagaacttagagatgaag
ttgagtacggtggtgtaggcacttatattggtgctactgaaaatgcgaatcataatttat
ttatctaattaaatctattaataaaaggagttgttatcatgttttttaaacagttttacg
ataatcatttatctcaagcatcatatttagtgggttgtcaacgtacaggagaggcaataa
taatagaccctgttcgtgatttatcgaaatatatagaagttgcagattctgaaggtttaa
caattacacaagctacagaaacacatattcatgctgattttgcttcaggaattcgtgatg
tggctaaacgcttaaatgcaaatatatatgtgtctggcgaaggtgaagatgcattagggt
ataaaaatatgccatcaaaaacacaatttgttaaacatggagatatcattcaagtaggca
atgttaaattagaagttctgcatactccaggacacacgcctgaaagtattagctttttac
tcactgatttaggtggtggttcaagtgttccgatgggattatttagtggtgactttattt
ttgttggtgatataggtagacctgattt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005515       F:protein binding
GO:0005737       C:cytoplasm
GO:0008033       P:tRNA processing
GO:0016783       F:sulfurtransferase activity
cmr|NT03SA0063 Staphylococcus aureus MW2     Uncharacterized protein family UPF0033 family
cmr|NT05SA0032 Staphylococcus aureus NCTC 8325     pyridine nucleotide-disulphide oxidoreductase family protein
cmr|NT09SA0054 Staphylococcus aureus subsp. aureus MSSA476     unnamed protein product; ORF6
cmr|SACOL0063 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0085 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB93921.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF66299.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG41824.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|196620.1.peg.56 Staphylococcus aureus subsp. aureus MW2 FIG   Disulfide bond regulator
fig|196620.5.peg.60 Staphylococcus aureus subsp. aureus MW2 FIG   Disulfide bond regulator
fig|282459.1.peg.49 Staphylococcus aureus subsp. aureus MSSA476 FIG   Disulfide bond regulator
fig|282459.5.peg.58 Staphylococcus aureus subsp. aureus MSSA476 FIG   Disulfide bond regulator
fig|367830.3.peg.754 Staphylococcus aureus subsp. aureus USA300 FIG   Disulfide bond regulator
fig|426430.6.peg.29 Staphylococcus aureus subsp. aureus str. Newman FIG   Disulfide bond regulator
fig|426430.8.peg.30 Staphylococcus aureus subsp. aureus str. Newman FIG   Disulfide bond regulator
fig|451516.9.peg.122 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Disulfide bond regulator
fig|452948.4.peg.946 Staphylococcus aureus 930918-3 FIG   Disulfide bond regulator
fig|455227.3.peg.1484 Staphylococcus aureus D30 FIG   Disulfide bond regulator
fig|548475.3.peg.2342 Staphylococcus aureus subsp. aureus TCH70 FIG   Disulfide bond regulator
fig|553567.3.peg.1743 Staphylococcus aureus A5948 FIG   Disulfide bond regulator
fig|553590.4.peg.2481 Staphylococcus aureus A9754 FIG   Disulfide bond regulator
fig|553594.3.peg.2679 Staphylococcus aureus A9765 FIG   Disulfide bond regulator
fig|762962.3.peg.1755 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Disulfide bond regulator
fig|93061.3.peg.64 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Disulfide bond regulator
fig|93061.5.peg.30 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Disulfide bond regulator
fig|93062.19.peg.59 Staphylococcus aureus subsp. aureus COL FIG   Disulfide bond regulator
fig|93062.4.peg.74 Staphylococcus aureus subsp. aureus COL FIG   Disulfide bond regulator
gb|AAW38707.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22619.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29224.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28131.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0092
gb|EES56419.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV82901.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373039 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220239 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0027
gi|160367160 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0092
gi|161508351 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0092
gi|21203220 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21281785 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0056
gi|251803762 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251812767 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|257860067 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452230 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|49243404 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49484961 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0056
gi|57286613 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652427 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0063
gi|87128105 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162131 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0085
gi|87201414 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193856 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00035
img|637150851 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156262 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637297796 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637886744 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892715 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794387 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308059 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641770954 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0085 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0063 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0027 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW0056 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00035 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0056   KEGG   hypothetical protein
kegg|sax:USA300HOU_0092 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_644871.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0056
ref|YP_001331062.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0027
ref|YP_001574010.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0092
ref|YP_042182.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0056
ref|YP_184968.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0063
ref|YP_492803.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0085
ref|YP_498641.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00035
ref|ZP_04827240.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_05700244.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QD67 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YZ08 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5QEM4 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FKH5 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1R7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJT9 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GD41 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NYV5 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0056


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search