The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1180: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: BH2577 unknown conserved protein in B. subtilis
Translate Function Assignments



Context on contig NC_007793 from base 1165570 to 1177312 (11743 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1173 1165570 1165797 228 +           FIG01108137: hypothetical protein  
1174 1167049 1166102 948 - 304         putative permease locus|SAUSA300_1065, protein_id|YP_493763.1, gi|87161154, geneID|3914499
1175 1167298 1167486 189 + 248         FIG01108732: hypothetical protein  
rna.16 1168034 1167961 74 - 474         tRNA-Arg-TCT  
1176 1168398 1168532 135 + 363         antibacterial protein locus|SAUSA300_1067, protein_id|YP_493764.1, gi|87161881, geneID|3914569
1177 1168589 1168723 135 + 56         antibacterial protein locus|SAUSA300_1068, protein_id|YP_493765.1, gi|87160365, geneID|3913239
1178 1168856 1169542 687 + 132     1: 11   Pyrimidine 5'-nucleotidase YjjG (EC 3.1.3.5) locus|SAUSA300_1069, protein_id|YP_493766.1, gi|87161095, geneID|3914301
1179 1170091 1169651 441 - 108 4 1: 1   Uncharacterized N-acetyltransferase BT9727_3663 locus|SAUSA300_1070, protein_id|YP_493767.1, gi|87161564, geneID|3915179
1180 1170286 1171899 1614 + 194   3: 6 8 1   BH2577 unknown conserved protein in B. subtilis locus|SAUSA300_1071, protein_id|YP_493768.1, gi|87162237, geneID|3914862
1181 1172043 1172474 432 + 143 5 4: 2 4 3 1   Transcriptional regulator MraZ gene_name|mraZ, locus|SAUSA300_1072, protein_id|YP_493769.1, gi|87161858, geneID|3913964
1182 1172490 1173425 936 + 15 6 3: 2 3 1 dlit(9287029) 16S rRNA (cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) ## RsmH gene_name|mraW, locus|SAUSA300_1073, protein_id|YP_493770.1, gi|87161763, geneID|3913908
1183 1173439 1173840 402 + 13     4: 2 4 3 1   Cell division protein FtsL gene_name|ftsL, locus|SAUSA300_1074, protein_id|YP_493771.1, gi|87160704, geneID|3912819
1184 1173821 1176055 2235 + -20 4 6: 9 2 5 4 3 1   Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129) gene_name|pbpA, locus|SAUSA300_1075, protein_id|YP_493772.1, gi|87162081, geneID|3914624
1185 1176347 1177312 966 + 291     3: 10 5 7 dlit(9287029)
dlit(10564498)
Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) gene_name|mraY, locus|SAUSA300_1076, protein_id|YP_493773.1, gi|87160312, geneID|3914548

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
16S_rRNA_modification_within_P_site_of_ribosome BH2577 unknown conserved protein in B. subtilis
AdiR Ernst_Dustin_user BH2577 unknown conserved protein in B. subtilis
AdiR2 Ernst_Dustin_user BH2577 unknown conserved protein in B. subtilis


  Protein Sequence

>fig|451515.3.peg.1180 BH2577 unknown conserved protein in B. subtilis
MDCKVVSLNEKDQFIPKIKSSDPVITGLFQYDAAQQTSFEKRMSKENNGREAALANVIRE
YMSDLKLSSEQELNIQHLANGSKVVIGGQQAGLFGGPLYTFHKIFSIITLSKELTDTHKQ
QVVPVFWIAGEDHDFDEVNHTFVYNENHGSLHKVKYHTMEMPETTVSRYYPDKAELKQTL
KTMFIHMKETVHTQGLLEICDRIIDQYDSWTDMFKALLHETFKAYGVLFIDAQFEPLRKM
EAPMFKKILKKHQLLDDAFRATQQRTQNQGLNAMIQTDTNVHLFLHDENMRQLVSYDGKH
FKLNKTDKTYIKEEIINIAENQPELFSNNVVTRPLMEEWLFNTVAFVGGPSEIKYWAELK
DVFELFDVEMPIVMPRLRITYLNDRIEKLLSKYNIPLEKVLVDGVEGERSKFIREQASHQ
FIEKVEGMIEQQRRLNKDLLDEVAGNQNNINLVNKNNEIHIQQYDYLLKRYLLNIEREND
ISMKQFREIQETLHPMGGLQERIWNPLQILNDFGTDVFKPSTYPPLSYTFDHIIIKP

MD5 = d2c8f5d4484ce17cd2736b9ab3c63613


  DNA Sequence

>fig|451515.3.peg.1180 BH2577 unknown conserved protein in B. subtilis
atggactgtaaagtagttagtttaaatgaaaaagatcagtttataccaaaaataaagagc
agtgaccctgtaataacaggattatttcaatatgatgcagctcaacaaactagttttgaa
aaaaggatgtctaaagaaaataatggaagagaagcggcattagcgaatgttattcgtgaa
tatatgagtgatttaaagctttcaagtgaacaagaattaaacatacaacatttagctaat
ggttcaaaagttgtgattggtggacaacaagcagggcttttcgggggaccattgtataca
ttccataaaatattttcaatcattactttatctaaggaattaacggatacacataagcaa
caagtagtaccagttttttggattgcaggagaagatcatgatttcgatgaagtgaatcat
acatttgtttataacgaaaatcatgggtcgctgcataaggttaaatatcatacaatggag
atgccagagacgactgtctctagatattatcctgataaggctgagttgaaacaaacttta
aaaacgatgttcattcatatgaaagaaactgttcatacacaaggtctactggagatttgt
gacagaattattgaccaatatgactcgtggactgatatgtttaaagcactactgcatgaa
acatttaaagcatatggcgttctatttatagatgcgcagtttgagccgttaagaaaaatg
gaagcgcctatgtttaaaaagattttgaaaaaacatcagttgcttgatgatgcttttaga
gcaacacaacaacgtactcaaaatcaaggcttgaatgcgatgatacaaacagatacaaat
gttcatttattcttacatgatgaaaatatgcgtcaattagtttcgtatgatggtaagcat
tttaaattaaataaaacagataagacatatataaaggaagaaattataaatattgcggaa
aatcaacctgaattattttctaataatgtagtgacaagaccattaatggaagaatggtta
tttaacacggtggcatttgttggaggaccgagtgaaattaagtactgggctgaactaaaa
gatgtatttgaactatttgatgttgaaatgcctatcgtgatgccaaggcttagaattact
tatttaaatgaccgtatagaaaaattactttcgaaatacaatattccattagaaaaagtg
ttagtcgatggtgttgaaggagaaagaagtaagtttattagagaacaagcatcacatcaa
tttattgaaaaggtagaaggtatgattgaacaacagcgtcgtctaaacaaagacttatta
gatgaagtggcggggaatcaaaataatattaaccttgtgaataaaaataatgaaattcat
atacaacagtatgattatttgttaaaacgttatcttttaaacattgaaagagaaaacgac
atcagtatgaagcaatttagagaaattcaagaaacactccatccaatgggaggattacaa
gaaagaatatggaatccacttcaaattttgaatgattttgggacagatgtgttcaagccc
tccacctatccaccactttcttacacttttgatcatattattataaaaccttaa


  DNA with Flanking Sequence

>fig|451515.3.peg.1180 BH2577 unknown conserved protein in B. subtilis
atcaatcaattctgaagcgtaccctctgttttgatattttggtaatacttctaacttcca
taataatatataatcttcaaaatctgggaagtagatttcttcgacatcacctttttttag
taatgccattctagctcctaattgatctccgacaaatatgccataaaatggtgaatctga
acttgcatcaatcatttgaccgtttaactcattgaccatgtataagtctttgttgccaaa
cgctctaaagttttcgaataattcgtcagttttgtaattaatttcaagacgtttgatttc
actcatatttatctaccccttatttgtttactactattattatacattaaaccacttgtg
tttttcattgatttgaaaatgtaaaacaatgaatattataaattttccatgattaaattg
attttcaagccgtaaaattgtcaatcaccggtatagactttatactatagtttgtaatcg
cgtacttaaggagaaaaaacatggactgtaaagtagttagtttaaatgaaaaagatcagt
ttataccaaaaataaagagcagtgaccctgtaataacaggattatttcaatatgatgcag
ctcaacaaactagttttgaaaaaaggatgtctaaagaaaataatggaagagaagcggcat
tagcgaatgttattcgtgaatatatgagtgatttaaagctttcaagtgaacaagaattaa
acatacaacatttagctaatggttcaaaagttgtgattggtggacaacaagcagggcttt
tcgggggaccattgtatacattccataaaatattttcaatcattactttatctaaggaat
taacggatacacataagcaacaagtagtaccagttttttggattgcaggagaagatcatg
atttcgatgaagtgaatcatacatttgtttataacgaaaatcatgggtcgctgcataagg
ttaaatatcatacaatggagatgccagagacgactgtctctagatattatcctgataagg
ctgagttgaaacaaactttaaaaacgatgttcattcatatgaaagaaactgttcatacac
aaggtctactggagatttgtgacagaattattgaccaatatgactcgtggactgatatgt
ttaaagcactactgcatgaaacatttaaagcatatggcgttctatttatagatgcgcagt
ttgagccgttaagaaaaatggaagcgcctatgtttaaaaagattttgaaaaaacatcagt
tgcttgatgatgcttttagagcaacacaacaacgtactcaaaatcaaggcttgaatgcga
tgatacaaacagatacaaatgttcatttattcttacatgatgaaaatatgcgtcaattag
tttcgtatgatggtaagcattttaaattaaataaaacagataagacatatataaaggaag
aaattataaatattgcggaaaatcaacctgaattattttctaataatgtagtgacaagac
cattaatggaagaatggttatttaacacggtggcatttgttggaggaccgagtgaaatta
agtactgggctgaactaaaagatgtatttgaactatttgatgttgaaatgcctatcgtga
tgccaaggcttagaattacttatttaaatgaccgtatagaaaaattactttcgaaataca
atattccattagaaaaagtgttagtcgatggtgttgaaggagaaagaagtaagtttatta
gagaacaagcatcacatcaatttattgaaaaggtagaaggtatgattgaacaacagcgtc
gtctaaacaaagacttattagatgaagtggcggggaatcaaaataatattaaccttgtga
ataaaaataatgaaattcatatacaacagtatgattatttgttaaaacgttatcttttaa
acattgaaagagaaaacgacatcagtatgaagcaatttagagaaattcaagaaacactcc
atccaatgggaggattacaagaaagaatatggaatccacttcaaattttgaatgattttg
ggacagatgtgttcaagccctccacctatccaccactttcttacacttttgatcatatta
ttataaaaccttaatataccaagggtttagcccgatttatcttaatgataaatcgggcat
ttttttgttttttaaaataaatttcacaaattttgtataaatagtggtggatagtgggga
gatgtggtaaattatatataaggtgaggtgataaaaaatgttcatgggagaatacgatca
tcaattagatacaaaaggacgtatgattataccgtccaagtttcgttatgacttaaatga
gcgttttattatcacaagaggccttgataaatgtttattcggttacactctagacgaatg
gcaacagattgaagagaaaatgaaaaccttacctatgacaaaaaaagacgcacgtaagtt
tatgcgtatgttcttctctggtgctgttgaagtagaacttgataagcaagggcgtattaa
catccctcaaaacttgaggaaatacgctaatttaactaaagaatgtacagtaatcggtgt
ttcaaatcgtattgagatttgggatagagaaact


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA1156 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT09SA1103 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|SAUSA300_1071 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB94925.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67359.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG42888.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|196620.1.peg.1060 Staphylococcus aureus subsp. aureus MW2 FIG   BH2577 unknown conserved protein in B. subtilis
fig|196620.5.peg.1114 Staphylococcus aureus subsp. aureus MW2 FIG   BH2577 unknown conserved protein in B. subtilis
fig|282459.1.peg.1105 Staphylococcus aureus subsp. aureus MSSA476 FIG   BH2577 unknown conserved protein in B. subtilis
fig|282459.5.peg.1156 Staphylococcus aureus subsp. aureus MSSA476 FIG   BH2577 unknown conserved protein in B. subtilis
fig|367830.3.peg.2499 Staphylococcus aureus subsp. aureus USA300 FIG   BH2577 unknown conserved protein in B. subtilis
fig|426430.6.peg.1055 Staphylococcus aureus subsp. aureus str. Newman FIG   BH2577 unknown conserved protein in B. subtilis
fig|426430.8.peg.1192 Staphylococcus aureus subsp. aureus str. Newman FIG   BH2577 unknown conserved protein in B. subtilis
fig|451516.9.peg.1184 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   BH2577 unknown conserved protein in B. subtilis
fig|452948.4.peg.670 Staphylococcus aureus 930918-3 FIG   BH2577 unknown conserved protein in B. subtilis
fig|455227.3.peg.738 Staphylococcus aureus D30 FIG   BH2577 unknown conserved protein in B. subtilis
fig|546342.3.peg.2501 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   BH2577 unknown conserved protein in B. subtilis
fig|546343.3.peg.662 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   BH2577 unknown conserved protein in B. subtilis
fig|548475.3.peg.90 Staphylococcus aureus subsp. aureus TCH70 FIG   BH2577 unknown conserved protein in B. subtilis
fig|553567.3.peg.1373 Staphylococcus aureus A5948 FIG   BH2577 unknown conserved protein in B. subtilis
fig|553590.4.peg.228 Staphylococcus aureus A9754 FIG   BH2577 unknown conserved protein in B. subtilis
fig|553594.3.peg.92 Staphylococcus aureus A9765 FIG   BH2577 unknown conserved protein in B. subtilis
fig|762962.3.peg.882 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   BH2577 unknown conserved protein in B. subtilis
gb|ABD22725.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABX29134.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1117
gb|EES54999.1 Staphylococcus aureus subsp. aureus TCH70     YllA like protein
gb|EEV83310.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45439.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1506
gb|EEW47767.1 Staphylococcus aureus D30     hypothetical protein SAD30_1581
gi|123486282 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0747 protein SAUSA300_1071
gi|150374099 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221299 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1087
gi|160368163 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1117
gi|161509354 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1117
gi|21204227 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282789 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1060
gi|221139451 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_12510
gi|221140651 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_03311
gi|239977722 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0747 protein NWMN_1087
gi|239977723 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0747 protein USA300HOU_1117
gi|251802342 Staphylococcus aureus subsp. aureus TCH70 NCBI   YllA like protein
gi|251814086 Staphylococcus aureus subsp. aureus TCH70 NCBI   YllA like protein
gi|257860483 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451875 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160414 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1506
gi|259163207 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1581
gi|49244460 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49486017 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1111
gi|81649453 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0747 protein SAS1111
gi|81762588 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0747 protein MW1060
gi|87128211 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162237 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1071
img|637157342 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298824 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887723 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|640795468 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309085 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771251 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1071 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sae:NWMN_1087 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW1060 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sas:SAS1111   KEGG   hypothetical protein
kegg|sax:USA300HOU_1117 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_645877.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1060
ref|YP_001332121.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1087
ref|YP_001575013.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1117
ref|YP_043238.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1111
ref|YP_493768.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1071
ref|ZP_03564250.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_12510
ref|ZP_03565144.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_03311
ref|ZP_04828559.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   YllA like protein
ref|ZP_05699896.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
sp|A6QG77 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=UPF0747 protein NWMN_1087
sp|A8Z3L8 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=UPF0747 protein USA300HOU_1117
sp|Q2FHR0 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=UPF0747 protein SAUSA300_1071
sp|Q6GA35 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=UPF0747 protein SAS1111
sp|Q8NX38 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=UPF0747 protein MW1060
sp|Y1060_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0747 protein MW1060
sp|Y1071_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0747 protein SAUSA300_1071
sp|Y1087_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0747 protein NWMN_1087
sp|Y1111_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0747 protein SAS1111
sp|Y1117_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0747 protein USA300HOU_1117
tr|C5QIE3 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   YllA like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|451515.3.peg.1179 Uncharacterized N-acetyltransferase BT9727_3663
5 fig|451515.3.peg.1181 Transcriptional regulator MraZ
6 fig|451515.3.peg.1182 16S rRNA (cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) ## RsmH
4 fig|451515.3.peg.1184 Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search