The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|451515.3.peg.1001: Staphylococcus aureus subsp. aureus USA300_FPR3757

This feature in The SEED Viewer

NCBI Taxonomy Id: 451515

Current Assignment: GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
Translate Function Assignments



Context on contig NC_007793 from base 988947 to 999890 (10944 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
995 988947 989561 615 +       1: 6   Competence protein CoiA locus|SAUSA300_0901, protein_id|YP_493601.1, gi|87160670, geneID|3915047
996 989609 991417 1809 + 47 5     Oligoendopeptidase F gene_name|pepF, locus|SAUSA300_0902, protein_id|YP_493602.1, gi|87161444, geneID|3914117
997 992683 991877 807 - 459 6 3: 5 12 1   FIG00002411: Thioredoxin-fold protein locus|SAUSA300_0903, protein_id|YP_493603.1, gi|87161245, geneID|3913854
998 993071 992706 366 - 22 4 1: 3   Hemoglobin-like protein HbO locus|SAUSA300_0904, protein_id|YP_493604.1, gi|87161957, geneID|3913714
999 993768 993175 594 - 103 11 5: 8 11 7 10 1   Adenylate cyclase (EC 4.6.1.1) locus|SAUSA300_0905, protein_id|YP_493605.1, gi|87161031, geneID|3913947
1000 993954 994301 348 + 185         UPF0738 protein YjbL locus|SAUSA300_0906, protein_id|YP_493606.1, gi|87161808, geneID|3914644
1001 994318 994953 636 + 16   1: 1   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM locus|SAUSA300_0907, protein_id|YP_493607.1, gi|87161055, geneID|3912765
1002 994970 995779 810 + 16 12 3: 4 9 1   NAD kinase (EC 2.7.1.23) gene_name|ppnK, locus|SAUSA300_0908, protein_id|YP_493608.1, gi|87160512, geneID|3914724
1003 995776 996630 855 + -4 12 2: 2 1   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type locus|SAUSA300_0909, protein_id|YP_493609.1, gi|87161458, geneID|3914049
1004 996651 998036 1386 + 20         Mg/Co/Ni transporter MgtE / CBS domain gene_name|mgtE, locus|SAUSA300_0910, protein_id|YP_493610.1, gi|87160433, geneID|3912936
1005 998046 999890 1845 + 9         K+/H+ antiporter / Trk system K+ uptake protein TrkA, NAD-binding C-terminal locus|SAUSA300_0911, protein_id|YP_493611.1, gi|87160688, geneID|3914182

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-222523.1.peg.1311 OlgaV GTP pyrophosphokinase (EC 2.7.6.5)


  Protein Sequence

>fig|451515.3.peg.1001 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND

MD5 = b9681fd6703d114c13c8abae4527bb8e


  DNA Sequence

>fig|451515.3.peg.1001 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
atgaatcaatgggatcagttcttaacaccttataagcaagcggttgatgagttgaaagtg
aaacttaaaggcatgcgcaaacaatatgaagttggtgaacaagcgtcgccaatagaattt
gttactggtcgtgttaaaccaatcgctagtattatagataaggcaaacaaacgacaaata
ccatttgataggttaagagaagaaatgtacgatatcgctggtttaagaatgatgtgccaa
tttgttgaagatattgatgttgtcgtcaatattttaagacaaagaaaagattttaaagta
attgaagaacgagattatattcgtaacactaaagaaagtggttaccgctcgtatcatgtc
attattgaatatccaattgaaacattacaaggccaaaaatttatattggctgagattcag
attcgtacattagcaatgaatttctgggcaacgattgaacatactttacgatataaatat
gatggtgcttatccggatgaaattcaacatcgtttggaaagagcggcagaagcagcgtat
ttacttgatgaagagatgtctgaaattaaagatgaaattcaggaagctcaaaaatattac
acgcaaaaacgttctaaaaaacatgaaaatgattaa


  DNA with Flanking Sequence

>fig|451515.3.peg.1001 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
aatgacaaagttgaattttaaaagtaatttcctttatctattatcaatgttaatttgacc
attaaaaatagtgttcgtaagtgttttgtattattgaattgtgttaaaatgttatggaat
aagaggaggattaagcatgcgtttatatattaatgaaattaaaattaaagatgacatact
ttattgttatacagaagattctattaaaggattatctgaagtaggacaaatgctcgttga
tagtgataattatgcctttgcgtatacattagatgatggtaaagcgtatgcttatctcat
tttcgtacaagaaacatggacgatgttgcatgaaaacatgactaaaaaaattattatcaa
tgatgaactagaattgactgaattccaccaagaacttacttatattttagacaacataaa
agggaataataattatggtaaggaatttgttgcaaccgttgaagaaacattcgacattga
ataaagcggggtgaagcactatgaatcaatgggatcagttcttaacaccttataagcaag
cggttgatgagttgaaagtgaaacttaaaggcatgcgcaaacaatatgaagttggtgaac
aagcgtcgccaatagaatttgttactggtcgtgttaaaccaatcgctagtattatagata
aggcaaacaaacgacaaataccatttgataggttaagagaagaaatgtacgatatcgctg
gtttaagaatgatgtgccaatttgttgaagatattgatgttgtcgtcaatattttaagac
aaagaaaagattttaaagtaattgaagaacgagattatattcgtaacactaaagaaagtg
gttaccgctcgtatcatgtcattattgaatatccaattgaaacattacaaggccaaaaat
ttatattggctgagattcagattcgtacattagcaatgaatttctgggcaacgattgaac
atactttacgatataaatatgatggtgcttatccggatgaaattcaacatcgtttggaaa
gagcggcagaagcagcgtatttacttgatgaagagatgtctgaaattaaagatgaaattc
aggaagctcaaaaatattacacgcaaaaacgttctaaaaaacatgaaaatgattaacgag
gtgttataaatcatgcgttatacaattttaactaaaggtgactccaagtctaatgcctta
aagcataaaatgatgaactatatgaaagattttcgcatgattgaggatagtgaaaatcct
gaaattgttatttcagttggtggtgacggtacattactacaagcattccatcagtatagc
cacatgttatcaaaagtggcatttgttggagttcatacaggtcatttaggattttatgcg
gattggttacctcatgaagttgaaaaattaatcatcgaaattaataattcagagtttcag
gtcattgaatatccattgcttgaaattattatgagatacaacgacaacggctatgaaaca
aggtatttagcattaaatgaagcaacgatgaaaactgaaaatggctcaacacttgttgtg
gatgttaacttaagagggaaacactttgagcgatttagaggcgatggattatgtgtatca
acaccttcgggttcaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008728       F:GTP diphosphokinase activity
GO:0015969       P:guanosine tetraphosphate metabolic process
GO:0016301       F:kinase activity
cmr|NT01SA0936 Staphylococcus aureus N315     GTP pyrophosphokinase [imported]
cmr|NT03SA0969 Staphylococcus aureus MW2     GTP pyrophosphokinase
cmr|NT05SA0850 Staphylococcus aureus NCTC 8325     RelA/SpoT
cmr|NT08SA0952 Staphylococcus aureus subsp. aureus MRSA252     GTP pyrophosphokinase family protein
cmr|NT09SA0880 Staphylococcus aureus subsp. aureus MSSA476     GTP pyrophosphokinase family protein
cmr|NT11SA0885 Staphylococcus aureus RF122     GTP pyrophosphokinase
cmr|SACOL1010 Staphylococcus aureus subsp. aureus COL     GTP pyrophosphokinase
cmr|SAUSA300_0907 Staphylococcus aureus subsp. aureus USA300-FPR3757     GTP pyrophosphokinase
dbj|BAB42105.1 Staphylococcus aureus subsp. aureus N315     GTP pyrophosphokinase
dbj|BAB94752.1 Staphylococcus aureus subsp. aureus MW2     GTP pyrophosphokinase
dbj|BAF67148.1 Staphylococcus aureus subsp. aureus str. Newman     GTP pyrophosphokinase
emb|CAG39978.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   conserved hypothetical protein
emb|CAG42650.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
emb|CAI80560.1 Staphylococcus aureus RF122 EMBL   GTP pyrophosphokinase
fig|158879.1.peg.888 Staphylococcus aureus subsp. aureus N315 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|158879.11.peg.920 Staphylococcus aureus subsp. aureus N315 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|196620.1.peg.887 Staphylococcus aureus subsp. aureus MW2 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|196620.5.peg.932 Staphylococcus aureus subsp. aureus MW2 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|273036.3.peg.992 Staphylococcus aureus RF122 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|273036.6.peg.929 Staphylococcus aureus RF122 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|282458.1.peg.910 Staphylococcus aureus subsp. aureus MRSA252 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|282458.4.peg.973 Staphylococcus aureus subsp. aureus MRSA252 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|282459.1.peg.869 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|282459.5.peg.911 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|359786.13.peg.1074 Staphylococcus aureus subsp. aureus JH9 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|359786.3.peg.35 Staphylococcus aureus subsp. aureus JH9 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|359787.11.peg.1057 Staphylococcus aureus subsp. aureus JH1 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|359787.3.peg.1757 Staphylococcus aureus subsp. aureus JH1 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|367830.3.peg.1142 Staphylococcus aureus subsp. aureus USA300 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|426430.6.peg.853 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|426430.8.peg.948 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|450394.6.peg.198 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|451516.9.peg.1005 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|452948.4.peg.1504 Staphylococcus aureus 930918-3 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|455227.3.peg.1363 Staphylococcus aureus D30 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|505321.3.peg.1689 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|546342.3.peg.456 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|546343.3.peg.2205 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|548470.3.peg.2639 Staphylococcus aureus subsp. aureus MN8 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|548473.3.peg.2352 Staphylococcus aureus subsp. aureus TCH60 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|548474.3.peg.1313 Staphylococcus aureus subsp. aureus TCH130 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|548475.3.peg.1234 Staphylococcus aureus subsp. aureus TCH70 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553565.3.peg.1800 Staphylococcus aureus A5937 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553567.3.peg.1545 Staphylococcus aureus A5948 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553568.3.peg.2285 Staphylococcus aureus A6224 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553571.3.peg.2015 Staphylococcus aureus A6300 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553573.3.peg.247 Staphylococcus aureus A8115 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553574.3.peg.1369 Staphylococcus aureus A8117 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553577.3.peg.1472 Staphylococcus aureus A8796 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553580.3.peg.951 Staphylococcus aureus A8819 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553581.3.peg.1055 Staphylococcus aureus A9299 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553583.3.peg.1024 Staphylococcus aureus A9635 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553588.3.peg.2212 Staphylococcus aureus A9719 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553590.4.peg.48 Staphylococcus aureus A9754 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553592.3.peg.34 Staphylococcus aureus A9763 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553594.3.peg.1651 Staphylococcus aureus A9765 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553596.3.peg.2184 Staphylococcus aureus A9781 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|553601.3.peg.857 Staphylococcus aureus A10102 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585143.3.peg.1452 Staphylococcus aureus subsp. aureus 55/2053 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585144.3.peg.1820 Staphylococcus aureus subsp. aureus 58-424 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585145.3.peg.1444 Staphylococcus aureus subsp. aureus 65-1322 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585146.3.peg.1448 Staphylococcus aureus subsp. aureus 68-397 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585147.3.peg.485 Staphylococcus aureus subsp. aureus A017934/97 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585148.3.peg.483 Staphylococcus aureus subsp. aureus Btn1260 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585149.6.peg.1070 Staphylococcus aureus subsp. aureus C101 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585150.3.peg.1510 Staphylococcus aureus subsp. aureus C160 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585151.3.peg.539 Staphylococcus aureus subsp. aureus C427 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585152.3.peg.851 Staphylococcus aureus subsp. aureus D139 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585153.3.peg.1510 Staphylococcus aureus subsp. aureus E1410 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585154.3.peg.919 Staphylococcus aureus subsp. aureus EMRSA16 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585155.3.peg.2277 Staphylococcus aureus subsp. aureus H19 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585156.3.peg.468 Staphylococcus aureus subsp. aureus M1015 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585157.3.peg.588 Staphylococcus aureus subsp. aureus M809 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585158.3.peg.1438 Staphylococcus aureus subsp. aureus M876 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585159.3.peg.1054 Staphylococcus aureus subsp. aureus M899 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585160.3.peg.465 Staphylococcus aureus subsp. aureus WBG10049 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|585161.3.peg.674 Staphylococcus aureus subsp. aureus WW2703/97 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|644279.4.peg.1009 Staphylococcus aureus subsp. aureus 132 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|680649.3.peg.909 Staphylococcus aureus subsp. aureus MR1 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|681288.4.peg.973 Staphylococcus aureus subsp. aureus ED98 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|703339.3.peg.974 Staphylococcus aureus 04-02981 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|762962.3.peg.1065 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|93061.3.peg.673 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|93061.5.peg.863 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|93062.19.peg.984 Staphylococcus aureus subsp. aureus COL FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
fig|93062.4.peg.1161 Staphylococcus aureus subsp. aureus COL FIG   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
gb|AAW36478.1 Staphylococcus aureus subsp. aureus COL     GTP pyrophosphokinase
gb|ABD21543.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     GTP pyrophosphokinase
gb|ABD30067.1 Staphylococcus aureus subsp. aureus NCTC 8325     GTP pyrophosphokinase, putative
gb|ABQ48805.1 Staphylococcus aureus subsp. aureus JH9     RelA/SpoT domain protein
gb|ABR51879.1 Staphylococcus aureus subsp. aureus JH1     RelA/SpoT domain protein
gb|ABX28983.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     GTP diphosphokinase
gb|EEI94436.1 Staphylococcus aureus subsp. aureus MN8     GTP diphosphokinase
gb|EEJ61029.1 Staphylococcus aureus subsp. aureus TCH60     GTP diphosphokinase
gb|EES55248.1 Staphylococcus aureus subsp. aureus TCH70     GTP diphosphokinase
gb|EES93340.1 Staphylococcus aureus subsp. aureus USA300_TCH959     GTP diphosphokinase
gb|EES98143.1 Staphylococcus aureus subsp. aureus TCH130     GTP diphosphokinase
gb|EEV04164.1 Staphylococcus aureus subsp. aureus 55/2053     GTP pyrophosphokinase
gb|EEV06048.1 Staphylococcus aureus subsp. aureus 65-1322     RelA/SpoT domain-containing protein
gb|EEV09102.1 Staphylococcus aureus subsp. aureus 68-397     RelA/SpoT domain-containing protein
gb|EEV11289.1 Staphylococcus aureus subsp. aureus E1410     GTP pyrophosphokinase
gb|EEV14358.1 Staphylococcus aureus subsp. aureus M876     RelA/SpoT domain-containing protein
gb|EEV27573.1 Staphylococcus aureus A9781     RelA/SpoT domain-containing protein
gb|EEV65890.1 Staphylococcus aureus A9763     RelA/SpoT domain-containing protein
gb|EEV66639.1 Staphylococcus aureus A9719     RelA/SpoT domain-containing protein
gb|EEV70236.1 Staphylococcus aureus A9635     RelA/SpoT domain-containing protein
gb|EEV72920.1 Staphylococcus aureus A9299     RelA/SpoT domain-containing protein
gb|EEV76204.1 Staphylococcus aureus A8115     GTP pyrophosphokinase
gb|EEV77250.1 Staphylococcus aureus A6300     GTP pyrophosphokinase
gb|EEV79769.1 Staphylococcus aureus A6224     RelA/SpoT domain-containing protein
gb|EEV83091.1 Staphylococcus aureus A5948     GTP pyrophosphokinase
gb|EEV85687.1 Staphylococcus aureus A5937     RelA/SpoT domain-containing protein
gb|EEW44775.1 Staphylococcus aureus 930918-3     GTP pyrophosphokinase
gb|EEW47151.1 Staphylococcus aureus D30     GTP pyrophosphokinase
gi|13700809 Staphylococcus aureus subsp. aureus N315 NCBI   GTP pyrophosphokinase
gi|147740507 Staphylococcus aureus subsp. aureus JH9 NCBI   RelA/SpoT domain protein
gi|148267438 Staphylococcus aureus subsp. aureus JH9 NCBI   RelA/SpoT domain-containing protein
gi|149945943 Staphylococcus aureus subsp. aureus JH1 NCBI   RelA/SpoT domain protein
gi|150373888 Staphylococcus aureus subsp. aureus str. Newman NCBI   GTP pyrophosphokinase
gi|150393491 Staphylococcus aureus subsp. aureus JH1 NCBI   RelA/SpoT domain-containing protein
gi|151221088 Staphylococcus aureus subsp. aureus str. Newman NCBI   GTP pyrophosphokinase
gi|15926594 Staphylococcus aureus subsp. aureus N315 NCBI   GTP pyrophosphokinase
gi|160368012 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GTP diphosphokinase
gi|161509203 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GTP pyrophosphokinase
gi|21204054 Staphylococcus aureus subsp. aureus MW2 NCBI   GTP pyrophosphokinase
gi|21282616 Staphylococcus aureus subsp. aureus MW2 NCBI   GTP pyrophosphokinase
gi|221137473 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   GTP pyrophosphokinase
gi|221142150 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   GTP pyrophosphokinase
gi|227244677 Staphylococcus aureus subsp. aureus MN8 NCBI   GTP diphosphokinase
gi|227558956 Staphylococcus aureus subsp. aureus MN8 NCBI   GTP diphosphokinase
gi|227851231 Staphylococcus aureus subsp. aureus TCH60 NCBI   GTP diphosphokinase
gi|227900581 Staphylococcus aureus subsp. aureus TCH60 NCBI   GTP diphosphokinase
gi|251802591 Staphylococcus aureus subsp. aureus TCH70 NCBI   GTP diphosphokinase
gi|251813901 Staphylococcus aureus subsp. aureus TCH70 NCBI   GTP diphosphokinase
gi|253316167 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   GTP pyrophosphokinase
gi|253724611 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GTP diphosphokinase
gi|253729414 Staphylococcus aureus subsp. aureus TCH130 NCBI   GTP diphosphokinase
gi|253731612 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GTP diphosphokinase
gi|253732636 Staphylococcus aureus subsp. aureus TCH130 NCBI   GTP diphosphokinase
gi|257272032 Staphylococcus aureus subsp. aureus 55/2053 NCBI   GTP pyrophosphokinase
gi|257274561 Staphylococcus aureus subsp. aureus 65-1322 NCBI   RelA/SpoT domain-containing protein
gi|257278483 Staphylococcus aureus subsp. aureus 68-397 NCBI   RelA/SpoT domain-containing protein
gi|257281152 Staphylococcus aureus subsp. aureus E1410 NCBI   GTP pyrophosphokinase
gi|257284238 Staphylococcus aureus subsp. aureus M876 NCBI   RelA/SpoT domain-containing protein
gi|257425056 Staphylococcus aureus subsp. aureus 55/2053 NCBI   GTP pyrophosphokinase
gi|257427720 Staphylococcus aureus subsp. aureus 65-1322 NCBI   RelA/SpoT domain-containing protein
gi|257430355 Staphylococcus aureus subsp. aureus 68-397 NCBI   RelA/SpoT domain-containing protein
gi|257433059 Staphylococcus aureus subsp. aureus E1410 NCBI   GTP pyrophosphokinase
gi|257435956 Staphylococcus aureus subsp. aureus M876 NCBI   RelA/SpoT domain-containing protein
gi|257789233 Staphylococcus aureus A9781 NCBI   RelA/SpoT domain-containing protein
gi|257795261 Staphylococcus aureus A9781 NCBI   RelA/SpoT domain-containing protein
gi|257841449 Staphylococcus aureus A9763 NCBI   RelA/SpoT domain-containing protein
gi|257842211 Staphylococcus aureus A9719 NCBI   RelA/SpoT domain-containing protein
gi|257846212 Staphylococcus aureus A9635 NCBI   RelA/SpoT domain-containing protein
gi|257848937 Staphylococcus aureus A9299 NCBI   RelA/SpoT domain-containing protein
gi|257852278 Staphylococcus aureus A8115 NCBI   GTP pyrophosphokinase
gi|257854300 Staphylococcus aureus A6300 NCBI   GTP pyrophosphokinase
gi|257856866 Staphylococcus aureus A6224 NCBI   RelA/SpoT domain-containing protein
gi|257860259 Staphylococcus aureus A5948 NCBI   GTP pyrophosphokinase
gi|257862922 Staphylococcus aureus A5937 NCBI   RelA/SpoT domain-containing protein
gi|258406910 Staphylococcus aureus A9763 NCBI   RelA/SpoT domain-containing protein
gi|258421878 Staphylococcus aureus A9719 NCBI   RelA/SpoT domain-containing protein
gi|258423511 Staphylococcus aureus A9635 NCBI   RelA/SpoT domain-containing protein
gi|258435276 Staphylococcus aureus A9299 NCBI   RelA/SpoT domain-containing protein
gi|258441488 Staphylococcus aureus A8115 NCBI   GTP pyrophosphokinase
gi|258446968 Staphylococcus aureus A6300 NCBI   GTP pyrophosphokinase
gi|258449946 Staphylococcus aureus A6224 NCBI   RelA/SpoT domain-containing protein
gi|258452044 Staphylococcus aureus A5948 NCBI   GTP pyrophosphokinase
gi|258455042 Staphylococcus aureus A5937 NCBI   RelA/SpoT domain-containing protein
gi|259159733 Staphylococcus aureus 930918-3 NCBI   GTP pyrophosphokinase
gi|259162583 Staphylococcus aureus D30 NCBI   GTP pyrophosphokinase
gi|49241297 Staphylococcus aureus subsp. aureus MRSA252 NCBI   conserved hypothetical protein
gi|49244224 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49483168 Staphylococcus aureus subsp. aureus MRSA252 NCBI   GTP pyrophosphokinase
gi|49485781 Staphylococcus aureus subsp. aureus MSSA476 NCBI   GTP pyrophosphokinase
gi|57284384 Staphylococcus aureus subsp. aureus COL NCBI   GTP pyrophosphokinase
gi|57650198 Staphylococcus aureus subsp. aureus COL NCBI   GTP pyrophosphokinase
gi|82656149 Staphylococcus aureus RF122 NCBI   GTP pyrophosphokinase
gi|82750618 Staphylococcus aureus RF122 NCBI   GTP pyrophosphokinase
gi|87127029 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   GTP pyrophosphokinase
gi|87161055 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   GTP pyrophosphokinase
gi|87202257 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GTP pyrophosphokinase, putative
gi|88194699 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GTP pyrophosphokinase
img|637092505 Staphylococcus aureus aureus N315 IMG   GTP pyrophosphokinase
img|637151775 Staphylococcus aureus aureus COL IMG   GTP pyrophosphokinase( EC:2.7.6.5 )
img|637154414 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637157103 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298648 Staphylococcus aureus aureus MW2 IMG   GTP pyrophosphokinase
img|637815827 Staphylococcus aureus RF122 IMG   GTP pyrophosphokinase( EC:2.7.6.5 )
img|637887559 Staphylococcus aureus aureus USA300 IMG   GTP pyrophosphokinase( EC:2.7.6.5 )
img|637893586 Staphylococcus aureus aureus NCTC 8325 IMG   GTP pyrophosphokinase, putative
img|639108926 Staphylococcus aureus aureus JH1 IMG   RelA/SpoT
img|640565354 Staphylococcus aureus aureus JH9 IMG   RelA/SpoT domain protein
img|640779110 Staphylococcus aureus aureus JH1 IMG   RelA/SpoT domain protein
img|640795254 Staphylococcus aureus aureus Newman IMG   GTP pyrophosphokinase
img|641308931 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   GTP diphosphokinase( EC:2.7.6.5 )
img|641772720 Staphylococcus aureus aureus USA300_TCH959 IMG   GTP diphosphokinase
kegg|saa:SAUSA300_0907 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   GTP pyrophosphokinase (EC:2.7.6.5)
kegg|sab:SAB0872 Staphylococcus aureus RF122 KEGG   GTP pyrophosphokinase (EC:2.7.6.5)
kegg|sac:SACOL1010 Staphylococcus aureus subsp. aureus COL KEGG   GTP pyrophosphokinase (EC:2.7.6.5)
kegg|sae:NWMN_0876 Staphylococcus aureus subsp. aureus Newman KEGG   GTP pyrophosphokinase
kegg|sah:SaurJH1_1023 Staphylococcus aureus subsp. aureus JH1 KEGG   RelA/SpoT domain-containing protein
kegg|saj:SaurJH9_1004 Staphylococcus aureus subsp. aureus JH9 KEGG   RelA/SpoT domain-containing protein
kegg|sam:MW0887 Staphylococcus aureus subsp. aureus MW2 KEGG   GTP pyrophosphokinase
kegg|sao:SAOUHSC_00942 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   GTP pyrophosphokinase
kegg|sar:SAR0973   KEGG   GTP pyrophosphokinase
kegg|sas:SAS0875   KEGG   GTP pyrophosphokinase
kegg|sau:SA0864   KEGG   GTP pyrophosphokinase
kegg|sax:USA300HOU_0963 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   GTP pyrophosphokinase (EC:2.7.6.5)
ref|NP_374127.1 Staphylococcus aureus subsp. aureus N315 RefSeq   GTP pyrophosphokinase
ref|NP_645704.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   GTP pyrophosphokinase
ref|YP_001246381.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   RelA/SpoT domain-containing protein
ref|YP_001316166.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   RelA/SpoT domain-containing protein
ref|YP_001331910.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   GTP pyrophosphokinase
ref|YP_001574862.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   GTP pyrophosphokinase
ref|YP_040392.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   GTP pyrophosphokinase
ref|YP_043002.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   GTP pyrophosphokinase
ref|YP_185878.1 Staphylococcus aureus subsp. aureus COL RefSeq   GTP pyrophosphokinase
ref|YP_416359.1 Staphylococcus aureus RF122 RefSeq   GTP pyrophosphokinase
ref|YP_493607.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   GTP pyrophosphokinase
ref|YP_499495.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   GTP pyrophosphokinase
ref|ZP_03562279.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   GTP pyrophosphokinase
ref|ZP_03566643.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   GTP pyrophosphokinase
ref|ZP_03989003.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   GTP diphosphokinase
ref|ZP_04018386.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   GTP diphosphokinase
ref|ZP_04828374.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   GTP diphosphokinase
ref|ZP_04839380.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   GTP pyrophosphokinase
ref|ZP_04865777.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   GTP diphosphokinase
ref|ZP_04866801.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   GTP diphosphokinase
ref|ZP_05601482.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   GTP pyrophosphokinase
ref|ZP_05604118.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05606737.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05609417.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   GTP pyrophosphokinase
ref|ZP_05612003.1 Staphylococcus aureus subsp. aureus M876 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05644240.1 Staphylococcus aureus A9781 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05680063.1 Staphylococcus aureus A9763 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05684799.1 Staphylococcus aureus A9719 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05686401.1 Staphylococcus aureus A9635 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05689015.1 Staphylococcus aureus A9299 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05690848.1 Staphylococcus aureus A8115 RefSeq   GTP pyrophosphokinase
ref|ZP_05695121.1 Staphylococcus aureus A6300 RefSeq   GTP pyrophosphokinase
ref|ZP_05698044.1 Staphylococcus aureus A6224 RefSeq   RelA/SpoT domain-containing protein
ref|ZP_05700060.1 Staphylococcus aureus A5948 RefSeq   GTP pyrophosphokinase
ref|ZP_05703005.1 Staphylococcus aureus A5937 RefSeq   RelA/SpoT domain-containing protein
tr|A5IRI2 Staphylococcus aureus (strain JH9) TrEMBL   RelA/SpoT domain protein
tr|A6QFL6 Staphylococcus aureus (strain Newman) TrEMBL   GTP pyrophosphokinase
tr|A6U0B1 Staphylococcus aureus (strain JH1) TrEMBL   RelA/SpoT domain protein
tr|A8Z0A9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   GTP diphosphokinase
tr|C2GDF3 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   GTP diphosphokinase
tr|C2KA63 Staphylococcus aureus subsp. aureus MN8 TrEMBL   GTP diphosphokinase
tr|C5N485 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   GTP diphosphokinase
tr|C5PY34 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   GTP diphosphokinase
tr|C5QHV8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   GTP diphosphokinase
tr|Q2FI71 Staphylococcus aureus (strain USA300) TrEMBL   GTP pyrophosphokinase
tr|Q2G204 Staphylococcus aureus (strain NCTC 8325) TrEMBL   GTP pyrophosphokinase, putative
tr|Q2YWX7 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   GTP pyrophosphokinase
tr|Q5HH79 Staphylococcus aureus (strain COL) TrEMBL   GTP pyrophosphokinase
tr|Q6GAS1 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GI80 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A1A3 Staphylococcus aureus (strain MW2) TrEMBL   GTP pyrophosphokinase
tr|Q99V85 Staphylococcus aureus (strain N315) TrEMBL   GTP pyrophosphokinase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
12 fig|451515.3.peg.1002 NAD kinase (EC 2.7.1.23)
12 fig|451515.3.peg.1003 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
5 fig|451515.3.peg.996 Oligoendopeptidase F
6 fig|451515.3.peg.997 FIG00002411: Thioredoxin-fold protein
4 fig|451515.3.peg.998 Hemoglobin-like protein HbO
11 fig|451515.3.peg.999 Adenylate cyclase (EC 4.6.1.1)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search