The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|443906.13.peg.2369: Clavibacter michiganensis subsp. michiganensis NCPPB 382

This feature in The SEED Viewer

NCBI Taxonomy Id: 443906

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig NC_009480 from base 2530641 to 2545028 (14388 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2362 2532020 2530641 1380 -           Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), substrate-binding protein UgpB locus|CMM_2238, protein_id|YP_001222983.1, gi|148273422, geneID|5174932
2363 2532996 2532082 915 - 61         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpE locus|CMM_2239, protein_id|YP_001222984.1, gi|148273423, geneID|5173918
2364 2533982 2532993 990 - -4         Glycerol-3-phosphate ABC transporter (EC 7.6.2.10), permease protein UgpA locus|CMM_2240, protein_id|YP_001222985.1, gi|148273424, geneID|5175228
2365 2534509 2534162 348 - 179         FIG00511185: hypothetical protein locus|CMM_2241, protein_id|YP_001222986.1, gi|148273425, geneID|5173891
2366 2535387 2534506 882 - -4 4 1: 1   Mycothiol S-conjugate amidase Mca locus|CMM_2242, protein_id|YP_001222987.1, gi|148273426, geneID|5174635
2367 2535454 2535936 483 + 66         FIG00512074: hypothetical protein locus|CMM_2243, protein_id|YP_001222988.1, gi|148273427, geneID|5174238
2368 2535997 2536485 489 + 60 6 1: 2   Transcription elongation factor GreA gene_name|greA, locus|CMM_2244, protein_id|YP_001222989.1, gi|148273428, geneID|5174370
2369 2537928 2536552 1377 - 66   2: 3 4   Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) gene_name|ilvA, locus|CMM_2245, protein_id|YP_001222990.1, gi|148273429, geneID|5174762
2370 2539160 2537925 1236 - -4         Uncharacterized membrane protein Rv0205 locus|CMM_2246, protein_id|YP_001222991.1, gi|148273430, geneID|5173535
2371 2539261 2540511 1251 + 100         Putative cytoplasmic protein locus|CMM_2247, protein_id|YP_001222992.1, gi|148273431, geneID|5175039
2372 2541088 2540522 567 - 10         LemA protein locus|CMM_2248, protein_id|YP_001222993.1, gi|148273432, geneID|5173873
2373 2542593 2541091 1503 - 2         Beta-glucosidase (EC 3.2.1.21) gene_name|bglL, locus|CMM_2249, protein_id|YP_001222994.1, gi|148273433, geneID|5175028
2374 2542830 2545028 2199 + 236         FIG00511794: hypothetical protein locus|CMM_2250, protein_id|YP_001222995.1, gi|148273434, geneID|5175420

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase (EC 4.3.1.19)


  Protein Sequence

>fig|443906.13.peg.2369 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MTDAAPARTPAEEAAAAPHADLPHLRAVGDELDPSQLGEDAAALAGELPRGSAPTLARIE
AARAVVSRVAEVTPMESSRFLAEILGSPVHLKCENLQRTGSYKIRGAYNRISRLTDEEKA
RGVVAASAGNHAQGVAFAARELGIRATIFMPVGVALPKLQATRQYGAEVILRGHTVAEPL
LAAAEFAAQTGAVLIPPFDHEDVITGQATLGLEILDQTPDVETVVVPIGGGGLISGVATA
LKLRAAEEGRTIRVVGVQARNAAAYPPSLAAGRATEIEITPTIADGIAVAKPGLLNFDII
RESVDEVVTVEDDDTARALLLLLERAKLVVEPAGAVGVAAILAGLVTDAGRTVVILSGGN
IDPLMMERVISRGLAASDRYVKLRIMLPDRPGQLARTSQIISEANANVVEVLHTRHGRGL
QISEVELEVSVETRGPEHTGEVVQRLRDAGYDPRLQHD

MD5 = aa7974b48a01aff320dcf3d30346ca64


  DNA Sequence

>fig|443906.13.peg.2369 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgaccgacgccgcacccgcccggacccccgccgaagaggctgccgccgcgccgcacgcc
gacctgccgcacctgcgcgccgtcggcgacgagctcgacccgtcgcagctgggggaggac
gccgcggcgctcgccggggagctgccccgcggatccgcgcccacgctcgcgcgcatcgag
gccgcccgcgcggtcgtcagccgcgtcgccgaggtgacgccgatggagtcgtcgcggttc
ctcgcggagatcctcggcagccccgtgcacctgaagtgcgagaacctgcagcgcaccggc
tcgtacaagatccgcggcgcctacaaccgcatctcgcgcctcaccgacgaggagaaggcg
cgcggcgtcgtggcggcgtcggccggcaaccacgcgcagggcgtggcgttcgcggcgcgc
gagctcgggatccgcgccacgatcttcatgcccgtcggcgtcgcgctccccaagctccag
gccacccgccagtacggcgccgaggtcatcctgcgcgggcacacggtcgccgagccgctc
ctcgccgccgccgagttcgccgcgcagacgggcgccgtgctcatcccgccgttcgaccac
gaggacgtcatcacgggccaggcaacgctcggcctcgagatcctcgaccagacgccggac
gtggagacggtcgtcgtcccgatcggcggcggcgggctgatctccggcgtcgcgaccgcg
ctcaagctgcgcgccgccgaggagggccgcacgatccgcgtcgtcggcgtgcaggcgcgc
aacgccgccgcctacccgccgtccctcgccgcgggtcgcgcgaccgagatcgagatcacg
ccgaccatcgccgacggcatcgcggtcgcgaagcccggcctgctcaacttcgacatcatc
cgcgagagcgtcgacgaggtcgtcacggtcgaggacgacgacaccgcgcgcgccctgctg
ctgctcctcgagcgcgcgaagctcgtggtcgagcccgcgggcgccgtgggcgtcgcggcc
atcctcgcggggctcgtgacggacgccggccgcaccgtcgtgatcctctcgggcggcaac
atcgacccgctcatgatggagcgcgtcatcagccgcggcctcgccgcgagcgaccgctac
gtgaagctgcggatcatgctgcccgaccgcccgggccagctcgcgcgcacctcgcagatc
atctccgaggcgaacgcgaacgtcgtcgaggtgctgcacacgcgccacggccgcggcctg
cagatcagcgaggtcgagctcgaggtgagcgtggagacgcgcggacccgagcacacgggc
gaggtcgtccagcgcctgcgcgacgcgggctacgacccgcgcctccagcacgactga


  DNA with Flanking Sequence

>fig|443906.13.peg.2369 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
ttcgtgaaggtgcaggtgctcgtcgccctcatcgacgcggtcggcatcgccggcggcgcc
gcgatcatcggggtgccgctcgcgatccccatcggcgtgctggtgttcctcgggtcgttc
atcccgatcgtcggcgcggtcgtcacgggtacgctcgccgtgttcgtggccctcgtctac
aacgggctgacgcaggcgctcatcatggtcggcatcgtgctcctcgtgcagcaggtcgag
ggccacgtcctccagccgctcatcatgggctcggtcgtcaaggtgcatccgctcgcggtc
gtgctctcggtggcggccggcggcatggtcgccggcatcgcgggcaccttcttcgccgtg
ccgctcgtcgcgaccctcaactccatggtcaagcacgtcgccagcggggcgtggcggggg
cagcccgagccgccgcctcccgcggtccccgccgacgccgcgcacgccacccgccgcccg
aacccgaggaagcccacccgatgaccgacgccgcacccgcccggacccccgccgaagagg
ctgccgccgcgccgcacgccgacctgccgcacctgcgcgccgtcggcgacgagctcgacc
cgtcgcagctgggggaggacgccgcggcgctcgccggggagctgccccgcggatccgcgc
ccacgctcgcgcgcatcgaggccgcccgcgcggtcgtcagccgcgtcgccgaggtgacgc
cgatggagtcgtcgcggttcctcgcggagatcctcggcagccccgtgcacctgaagtgcg
agaacctgcagcgcaccggctcgtacaagatccgcggcgcctacaaccgcatctcgcgcc
tcaccgacgaggagaaggcgcgcggcgtcgtggcggcgtcggccggcaaccacgcgcagg
gcgtggcgttcgcggcgcgcgagctcgggatccgcgccacgatcttcatgcccgtcggcg
tcgcgctccccaagctccaggccacccgccagtacggcgccgaggtcatcctgcgcgggc
acacggtcgccgagccgctcctcgccgccgccgagttcgccgcgcagacgggcgccgtgc
tcatcccgccgttcgaccacgaggacgtcatcacgggccaggcaacgctcggcctcgaga
tcctcgaccagacgccggacgtggagacggtcgtcgtcccgatcggcggcggcgggctga
tctccggcgtcgcgaccgcgctcaagctgcgcgccgccgaggagggccgcacgatccgcg
tcgtcggcgtgcaggcgcgcaacgccgccgcctacccgccgtccctcgccgcgggtcgcg
cgaccgagatcgagatcacgccgaccatcgccgacggcatcgcggtcgcgaagcccggcc
tgctcaacttcgacatcatccgcgagagcgtcgacgaggtcgtcacggtcgaggacgacg
acaccgcgcgcgccctgctgctgctcctcgagcgcgcgaagctcgtggtcgagcccgcgg
gcgccgtgggcgtcgcggccatcctcgcggggctcgtgacggacgccggccgcaccgtcg
tgatcctctcgggcggcaacatcgacccgctcatgatggagcgcgtcatcagccgcggcc
tcgccgcgagcgaccgctacgtgaagctgcggatcatgctgcccgaccgcccgggccagc
tcgcgcgcacctcgcagatcatctccgaggcgaacgcgaacgtcgtcgaggtgctgcaca
cgcgccacggccgcggcctgcagatcagcgaggtcgagctcgaggtgagcgtggagacgc
gcggacccgagcacacgggcgaggtcgtccagcgcctgcgcgacgcgggctacgacccgc
gcctccagcacgactgagcgacgcgcacgcgaggaggggcgcggaccacatggtccgcgc
ccctcgtcatcgtgccgctcgccctacggtgtgtagttctccacggcctggatctcgacg
gggatctcgcggccgttcggcgcggtgtacgcgcccttctgcccgacctcccagccgatg
atggcggcgccgagcggcgactgctcgctgtagacgtcgaggtcgctgtcgcccgcgatc
tcgcggttgccgagcaggaacttcgtctcgtcgccggcgatgagcgcggtgacgaccgtt
ccgggctccacgacgccgtggctctcgggggcgtcgccgagctcggccgtccgcagcagc
tgcgtgagctggcggatgcgcgcctcgatcttgccctgctcctccttggcggcgtggtag
ccgccgttctccttgaggtcgccctcctcgcgggcgatctcgatcttcttcgcgatctcc
tcgcggccctgcacgctgagggtgtcgagctccctgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|443906.9.peg.2249 Clavibacter michiganensis subsp. michiganensis NCPPB 382 FIG   Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|443906.13.peg.2366 Mycothiol S-conjugate amidase Mca
6 fig|443906.13.peg.2368 Transcription elongation factor GreA


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search