The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.994: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: membrane protein, putative
Translate Function Assignments



Context on contig NC_009641 from base 1013499 to 1025298 (11800 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
989 1013499 1014320 822 +       2: 3 6 dlit(20643650) Naphthoate synthase (EC 4.1.3.36) gene_name|memB, locus|NWMN_0915, protein_id|YP_001331949.1, gi|151221127, geneID|5330553
990 1014888 1014559 330 - 238         Staphostatin B gene_name|sspC, locus|NWMN_0916, protein_id|YP_001331950.1, gi|151221128, geneID|5332121
991 1016107 1014926 1182 - 37         Staphopain B precursor (EC 3.4.22.-) gene_name|sspB, locus|NWMN_0917, protein_id|YP_001331951.1, gi|151221129, geneID|5332511
992 1017199 1016189 1011 - 81     1: 2 dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA gene_name|sspA, locus|NWMN_0918, protein_id|YP_001331952.1, gi|151221130, geneID|5332509
993 1018881 1017727 1155 - 527     2: 8 4   N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) locus|NWMN_0919, protein_id|YP_001331953.1, gi|151221131, geneID|5332508
994 1020087 1019077 1011 - 195         membrane protein, putative locus|NWMN_0920, protein_id|YP_001331954.1, gi|151221132, geneID|5330554
995 1020240 1020659 420 + 152         Putative ATL autolysin transcription regulator locus|NWMN_0921, protein_id|YP_001331955.1, gi|151221133, geneID|5330555
996 1024636 1020866 3771 - 206     3: 9 5 1   Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)/ endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) gene_name|atl, locus|NWMN_0922, protein_id|YP_001331956.1, gi|151221134, geneID|5330556
997 1025298 1024864 435 - 227     1: 7   GNAT family acetyltransferase YjcF locus|NWMN_0923, protein_id|YP_001331957.1, gi|151221135, geneID|5331762

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.994 membrane protein, putative
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS

MD5 = df9b7052c6dd311eb2d87fc2c33be882


  DNA Sequence

>fig|426430.8.peg.994 membrane protein, putative
atgacttcattaaaagagagagattatttttttgacaacgcaagagcaattttaatatta
ttagtcgtatttggacatatgttacaaccctacactagtggcgataaatatttatcagca
ttatacctagttatttatagtttccatatgccaacatttttgtttatatctggttatttc
gcgaaaaatattgataaaccatactatttagaaaaaatttcaaaacgtttgatagtacct
tatatgatattttttgcattcttttcaatttattatttcttaacaggtaaaagtgacgaa
ttacaacttgatccttttaacccagtatttgcgttatggtttttgatcacgctatttttc
tttcatgtcattttagtaatagttagaagatttaatccatataaagtgctatcagtttca
attattatatctattggagcaggtttttcagataacatcgatagctacttaagcatttca
aggacaatcgtatttttcccaatattttatctaggttacattttcaccaaaaaacatacg
gctatttttaaaaataaaaaactaataccagtatctatcattacctttattttgtttttt
atcgtttacgtgattcatcctatcaatgcagattggttattgggaagttcaccatatact
tcacttgaaaatgaaggacagagtatattcagtccttttaaacgacttatattatatgga
attatattaatcgcaatgactgcgtttctaaatttaatgtcaacaaagaaaaaattatat
acttatattggtagtcgtacgctatacgtatatttattacatggtttaattattggcatt
gttagaggatttgaatggtacccattcgataatcctatatcattaatgacttatctttat
ttaataagtatatctgtaatcatcgtatatgtattatctacaaactttgtttgtaaatgg
acaaatccaataattaatttacaaagaccatcacagtttaaagattcataa


  DNA with Flanking Sequence

>fig|426430.8.peg.994 membrane protein, putative
acattgacatcttgcttcaatcaattcgcaacgtgcattatttatttgtgaaattaatgt
acgtgcttgatcagtcaaaattaattctttacatcttaaatcttcgctagattgttgact
tgtgatgtaccctttcaaaactaatttcttaatccaccttgaaactatagattgttccct
gctaatcttcatcgtcaaatcatactgtgataagcgatcgtaattaaataaaatacggag
aagttctagctgttcagatgtgatatccgtgcgttgtccaaatcttctattcactaagtt
taagtcattgttagtcagtgtaataagtttttcaagttgtttatacatgttgttctactc
cactacatattatttataatattatatgctttttttataatttttacaatactattcgac
acaatagacaaatttgttgcataactaatacaaaatataataaattagtaagagtcttat
ggacataaaggagataaaatatgacttcattaaaagagagagattatttttttgacaacg
caagagcaattttaatattattagtcgtatttggacatatgttacaaccctacactagtg
gcgataaatatttatcagcattatacctagttatttatagtttccatatgccaacatttt
tgtttatatctggttatttcgcgaaaaatattgataaaccatactatttagaaaaaattt
caaaacgtttgatagtaccttatatgatattttttgcattcttttcaatttattatttct
taacaggtaaaagtgacgaattacaacttgatccttttaacccagtatttgcgttatggt
ttttgatcacgctatttttctttcatgtcattttagtaatagttagaagatttaatccat
ataaagtgctatcagtttcaattattatatctattggagcaggtttttcagataacatcg
atagctacttaagcatttcaaggacaatcgtatttttcccaatattttatctaggttaca
ttttcaccaaaaaacatacggctatttttaaaaataaaaaactaataccagtatctatca
ttacctttattttgttttttatcgtttacgtgattcatcctatcaatgcagattggttat
tgggaagttcaccatatacttcacttgaaaatgaaggacagagtatattcagtcctttta
aacgacttatattatatggaattatattaatcgcaatgactgcgtttctaaatttaatgt
caacaaagaaaaaattatatacttatattggtagtcgtacgctatacgtatatttattac
atggtttaattattggcattgttagaggatttgaatggtacccattcgataatcctatat
cattaatgacttatctttatttaataagtatatctgtaatcatcgtatatgtattatcta
caaactttgtttgtaaatggacaaatccaataattaatttacaaagaccatcacagttta
aagattcataattttatactgtctaagtacattaactgtaaccactttattcattttgaa
aagtagttactacagtgtatttagacatttttcgtttttcaaataaagcttaagtaattt
acccttttttgctttaaaagtatgttatgatattattaatttctaaatttttagacaata
tttgatttatatttgaggtgtcacaaatgaaactttctttaaattctaattctaaatatt
taagagcaccaagtattcgccaattttcaaatcgtatgaataatttggatgattgtgtta
atttaactattggccaaccagacttcccgatgcctgatgttgtgaaaaaggcatatattg
atgctattaacaatgacaagacatcatactctcacaataaagggttattagaaactcgcg
aagcaattagtcaatacttcaaaaatcgttatcatttttcctatgatcctgaagaaatta
ttgtgacaaatggagcaagtgaagcaataga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016020       C:membrane
GO:0016747       F:transferase activity, transferring acyl gro...
cmr|NT03SA1018 Staphylococcus aureus MW2     membrane protein, putative
cmr|NT05SA0898 Staphylococcus aureus NCTC 8325     acyltransferase 3
cmr|NT09SA0982 Staphylococcus aureus subsp. aureus MSSA476     B. subtilis YkrP protein homolog lmo0995
cmr|SACOL1059 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0953 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAB94799.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67192.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG42761.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|196620.1.peg.934 Staphylococcus aureus subsp. aureus MW2 FIG   membrane protein, putative
fig|196620.5.peg.979 Staphylococcus aureus subsp. aureus MW2 FIG   membrane protein, putative
fig|282459.1.peg.978 Staphylococcus aureus subsp. aureus MSSA476 FIG   membrane protein, putative
fig|282459.5.peg.1021 Staphylococcus aureus subsp. aureus MSSA476 FIG   membrane protein, putative
fig|367830.3.peg.1518 Staphylococcus aureus subsp. aureus USA300 FIG   membrane protein, putative
fig|426430.6.peg.889 Staphylococcus aureus subsp. aureus str. Newman FIG   membrane protein, putative
fig|451515.3.peg.1046 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   membrane protein, putative
fig|451516.9.peg.1050 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   membrane protein, putative
fig|452948.4.peg.2062 Staphylococcus aureus 930918-3 FIG   membrane protein, putative
fig|546342.3.peg.1020 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   membrane protein, putative
fig|546343.3.peg.1887 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   membrane protein, putative
fig|548475.3.peg.1281 Staphylococcus aureus subsp. aureus TCH70 FIG   membrane protein, putative
fig|553567.3.peg.1499 Staphylococcus aureus A5948 FIG   membrane protein, putative
fig|553590.4.peg.94 Staphylococcus aureus A9754 FIG   membrane protein, putative
fig|553594.3.peg.2033 Staphylococcus aureus A9765 FIG   membrane protein, putative
fig|644279.4.peg.1055 Staphylococcus aureus subsp. aureus 132 FIG   membrane protein, putative
fig|762962.3.peg.1018 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   membrane protein, putative
fig|93061.3.peg.952 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   membrane protein, putative
fig|93061.5.peg.910 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   membrane protein, putative
fig|93062.19.peg.1030 Staphylococcus aureus subsp. aureus COL FIG   membrane protein, putative
fig|93062.4.peg.1228 Staphylococcus aureus subsp. aureus COL FIG   membrane protein, putative
gb|AAW36524.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20498.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD30115.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EES55296.1 Staphylococcus aureus subsp. aureus TCH70     possible acetyltransferase
gb|EEV83047.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44336.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1108
gi|150373932 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221132 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0920
gi|21204101 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282663 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0934
gi|221138028 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05148
gi|221141834 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_09416
gi|251802639 Staphylococcus aureus subsp. aureus TCH70 NCBI   possible acetyltransferase
gi|251813949 Staphylococcus aureus subsp. aureus TCH70 NCBI   possible acetyltransferase
gi|257860215 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452000 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159278 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1108
gi|49244333 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49485890 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0986
gi|57284430 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650244 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1059
gi|87125984 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87160010 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0953
gi|87202305 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194747 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00991
img|637151823 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157214 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298697 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887605 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893636 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795300 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641772573 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0953 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1059 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0920 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW0934 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00991 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0986   KEGG   hypothetical protein
ref|NP_645751.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0934
ref|YP_001331954.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0920
ref|YP_043111.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0986
ref|YP_185924.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1059
ref|YP_493651.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0953
ref|YP_499543.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00991
ref|ZP_03562830.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05148
ref|ZP_03566327.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_09416
ref|ZP_04828422.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   possible acetyltransferase
ref|ZP_05700016.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QFR0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|C5QI06 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Possible acetyltransferase
tr|Q2FI27 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2FZL0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HH33 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GAG2 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q8NX97 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0934


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search