The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.950: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
Translate Function Assignments



Context on contig NC_009641 from base 966256 to 978865 (12610 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
943 966256 968064 1809 +           Oligoendopeptidase F locus|NWMN_0870, protein_id|YP_001331904.1, gi|151221082, geneID|5330513
944 969330 968524 807 - 459     3: 9 14 1   FIG00002411: Thioredoxin-fold protein locus|NWMN_0872, protein_id|YP_001331906.1, gi|151221084, geneID|5330515
945 969718 969353 366 - 22     1: 2   Hemoglobin-like protein HbO locus|NWMN_0873, protein_id|YP_001331907.1, gi|151221085, geneID|5330516
946 970415 969822 594 - 103 13 5: 11 13 10 12 1   Adenylate cyclase (EC 4.6.1.1) locus|NWMN_0874, protein_id|YP_001331908.1, gi|151221086, geneID|5330517
947 970601 970948 348 + 185         UPF0738 protein YjbL locus|NWMN_0875, protein_id|YP_001331909.1, gi|151221087, geneID|5330518
948 970965 971600 636 + 16 12 1: 1   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM locus|NWMN_0876, protein_id|YP_001331910.1, gi|151221088, geneID|5330519
949 971617 972426 810 + 16 14 3: 3 5 1   NAD kinase (EC 2.7.1.23) gene_name|ppnK, locus|NWMN_0877, protein_id|YP_001331911.1, gi|151221089, geneID|5330520
950 972423 973277 855 + -4   2: 6 1   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type locus|NWMN_0878, protein_id|YP_001331912.1, gi|151221090, geneID|5330521
951 973298 974683 1386 + 20         Mg/Co/Ni transporter MgtE / CBS domain locus|NWMN_0879, protein_id|YP_001331913.1, gi|151221091, geneID|5330522
952 974693 976537 1845 + 9         K+/H+ antiporter / Trk system K+ uptake protein TrkA, NAD-binding C-terminal locus|NWMN_0880, protein_id|YP_001331914.1, gi|151221092, geneID|5330523
953 976815 977585 771 + 277     3: 4 8 7 dlit(11514139) Enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific) (EC 1.3.1.39) ## FabI locus|NWMN_0881, protein_id|YP_001331915.1, gi|151221093, geneID|5330524
954 978865 977780 1086 - 194 5     UPF0118 membrane protein SAV1012 locus|NWMN_0882, protein_id|YP_001331916.1, gi|151221094, geneID|5330525

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-222523.1.peg.1311 OlgaV Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
Ribosome_biogenesis_bacterial gjo Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type


  Protein Sequence

>fig|426430.8.peg.950 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL

MD5 = cb4ececa95fb30a0364791ed75ab3cb0


  DNA Sequence

>fig|426430.8.peg.950 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
atgaaatttaagtatcatatatcacaacaagaaactgttaaaacttttttagcacgacat
gatttttctaagaagacagtgagcgccattaaaaataatggcgctttaattgttaatgat
gaaccagtcacagtgcgtaagcaattaatgacaaatgatatattagaaattcatttaccg
cgagaaataccgagtgttaatttaataccttatgctcgtaagctagaagtattgtatgaa
gatgcttttatcatcatagttactaaaccaaacaatcaaaattgtacaccttcgagagaa
catcctcatgaaagtttaatcgaacaagtactatatcattgtcaggaacatggtgaaaat
attaacccacatattgttacgcgtctagatcgtaatacaactggtattgtgatattcgct
aaatatggacatatccatcatttattttctaaagtaaacttgaaaaaaatatatacttgc
cttgtatatggtaaaacccatacatctggtattattgaagctaatattagacggtcaaag
gataggattataactagagaagttgcctcggatggtaaatacgctaaaacatcttatgaa
gtaataaatcagaatgataaatacagtttatgcaaagttcatttgcatacgggacgtaca
catcaaattcgtgtacattttcaacatattgggcatccaattgtgggagattctttgtat
gatggttttcatgacaaaattcatggtcaagtactgcaatgtacgcaaatatattttgtt
catccaatcaataagaacaatatttatattacaattgattataagcaattacttaaatta
ttcaatcaactctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.950 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
cttgaaattattatgagatacaacgacaacggctatgaaacaaggtatttagcattaaat
gaagcaacgatgaaaactgaaaatggctcaacacttgttgtggatgttaacttaagaggg
aaacactttgagcgatttagaggcgatggattatgtgtatcaacaccttcgggttcaacg
gcttataacaaagcgctaggtggcgcactgatacatccttcacttgaagcaatgcaaatt
acagaaattgcctcgataaataatcgtgtgtttagaacggtaggatcaccacttgtatta
ccaaagcatcatacatgtttaatatcaccagttaatcatgataccattagaatgacgata
gatcatgttagtatcaaacataaaaatgttaattcaatacaataccgtgtagcaaatgaa
aaagtgaggtttgcacgttttagaccattcccattctggaaacgtgtgcacgattctttc
atatcaagtgatgaagaacgatgaaatttaagtatcatatatcacaacaagaaactgtta
aaacttttttagcacgacatgatttttctaagaagacagtgagcgccattaaaaataatg
gcgctttaattgttaatgatgaaccagtcacagtgcgtaagcaattaatgacaaatgata
tattagaaattcatttaccgcgagaaataccgagtgttaatttaataccttatgctcgta
agctagaagtattgtatgaagatgcttttatcatcatagttactaaaccaaacaatcaaa
attgtacaccttcgagagaacatcctcatgaaagtttaatcgaacaagtactatatcatt
gtcaggaacatggtgaaaatattaacccacatattgttacgcgtctagatcgtaatacaa
ctggtattgtgatattcgctaaatatggacatatccatcatttattttctaaagtaaact
tgaaaaaaatatatacttgccttgtatatggtaaaacccatacatctggtattattgaag
ctaatattagacggtcaaaggataggattataactagagaagttgcctcggatggtaaat
acgctaaaacatcttatgaagtaataaatcagaatgataaatacagtttatgcaaagttc
atttgcatacgggacgtacacatcaaattcgtgtacattttcaacatattgggcatccaa
ttgtgggagattctttgtatgatggttttcatgacaaaattcatggtcaagtactgcaat
gtacgcaaatatattttgttcatccaatcaataagaacaatatttatattacaattgatt
ataagcaattacttaaattattcaatcaactctaattcacacagggggtgtaagtatgtc
aatgaacacagatgaaaaagagcgtgttcaagaggaattatacgaccaaactttattaga
tcaatatttagaaaatgatgatattgatcaatttagagatgaatttctagcattacacac
atatgaacaaagtgagtattttgaagatactaccgatgaaaatagacaaaagatttttca
atatttatcacctgaagaagttgcaaatttctttgatcaattagatattgatgacgatga
atatgagttgctatttgataagatgaatgcgacatacgcaagtcacatattagaagaaat
gtcatacgacaatgcagtagatattttaaatgagttgactaaaccaaaagttgctagtct
tttaacattgatgaataaagatgacgcgaatgaaatcaaagcattacttcactatgatga
ggatacggccggcggtattatgacgacggagtatttatcacttaaagcgcatacg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0001522       P:pseudouridine synthesis
GO:0003723       F:RNA binding
GO:0009982       F:pseudouridine synthase activity
GO:0016829       F:lyase activity
cmr|NT05SA0852 Staphylococcus aureus NCTC 8325     ribosomal large subunit pseudouridine synthase, RluD subfamily
cmr|SACOL1012 Staphylococcus aureus subsp. aureus COL     ribosomal large subunit pseudouridine synthases, RluD subfamily
cmr|SAUSA300_0909 Staphylococcus aureus subsp. aureus USA300-FPR3757     pseudouridine synthases, RluA subfamily
dbj|BAF67150.1 Staphylococcus aureus subsp. aureus str. Newman     RNA pseudouridylate synthase
fig|367830.3.peg.1311 Staphylococcus aureus subsp. aureus USA300 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|426430.6.peg.855 Staphylococcus aureus subsp. aureus str. Newman FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|451515.3.peg.1003 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|451516.9.peg.1007 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|452948.4.peg.1506 Staphylococcus aureus 930918-3 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|455227.3.peg.1365 Staphylococcus aureus D30 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|546342.3.peg.458 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|553567.3.peg.1543 Staphylococcus aureus A5948 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|553590.4.peg.50 Staphylococcus aureus A9754 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|553594.3.peg.1653 Staphylococcus aureus A9765 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|644279.4.peg.1011 Staphylococcus aureus subsp. aureus 132 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|93061.3.peg.675 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|93061.5.peg.865 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|93062.19.peg.986 Staphylococcus aureus subsp. aureus COL FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
fig|93062.4.peg.1184 Staphylococcus aureus subsp. aureus COL FIG   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
gb|AAW36480.1 Staphylococcus aureus subsp. aureus COL     ribosomal large subunit pseudouridine synthases, RluD subfamily
gb|ABD21946.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     pseudouridine synthases, RluA subfamily
gb|ABD30069.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28985.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     pseudouridylate synthase
gb|EEV83089.1 Staphylococcus aureus A5948     ribosomal large subunit pseudouridine synthase D
gb|EEW44777.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0105
gb|EEW47153.1 Staphylococcus aureus D30     hypothetical protein SAD30_1651
gi|150373890 Staphylococcus aureus subsp. aureus str. Newman NCBI   RNA pseudouridylate synthase
gi|151221090 Staphylococcus aureus subsp. aureus str. Newman NCBI   RNA pseudouridylate synthase
gi|160368014 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   pseudouridylate synthase
gi|161509205 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   pseudouridylate synthase
gi|221137475 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   pseudouridylate synthase
gi|257860257 Staphylococcus aureus A5948 NCBI   ribosomal large subunit pseudouridine synthase D
gi|258452042 Staphylococcus aureus A5948 NCBI   ribosomal large subunit pseudouridine synthase D
gi|259159735 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0105
gi|259162585 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1651
gi|57284386 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal large subunit pseudouridine synthases, RluD subfamily
gi|57650200 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal large subunit pseudouridine synthase D
gi|87127432 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   pseudouridine synthases, RluA subfamily
gi|87161458 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   RluA family pseudouridine synthase
gi|87202259 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194701 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00944
img|637151777 Staphylococcus aureus aureus COL IMG   ribosomal large subunit pseudouridine synthase, RluD subfamily
img|637887561 Staphylococcus aureus aureus USA300 IMG   pseudouridine synthases, RluA subfamily
img|637893588 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795256 Staphylococcus aureus aureus Newman IMG   RNA pseudouridylate synthase
img|641308933 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   pseudouridylate synthase( EC:4.2.1.70 )
img|641772722 Staphylococcus aureus aureus USA300_TCH959 IMG   pseudouridylate synthase
kegg|saa:SAUSA300_0909 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   RluA family pseudouridine synthase
kegg|sac:SACOL1012 Staphylococcus aureus subsp. aureus COL KEGG   ribosomal large subunit pseudouridine synthase D
kegg|sae:NWMN_0878 Staphylococcus aureus subsp. aureus Newman KEGG   RNA pseudouridylate synthase
kegg|sao:SAOUHSC_00944 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0965 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   pseudouridylate synthase (EC:4.2.1.70)
ref|YP_001331912.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   RNA pseudouridylate synthase
ref|YP_001574864.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   pseudouridylate synthase
ref|YP_185880.1 Staphylococcus aureus subsp. aureus COL RefSeq   ribosomal large subunit pseudouridine synthase D
ref|YP_493609.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   RluA family pseudouridine synthase
ref|YP_499497.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00944
ref|ZP_03562281.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   pseudouridylate synthase
ref|ZP_05700058.1 Staphylococcus aureus A5948 RefSeq   ribosomal large subunit pseudouridine synthase D
tr|A6QFL8 Staphylococcus aureus (strain Newman) TrEMBL   Pseudouridine synthase
tr|A8Z0B1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Pseudouridine synthase
tr|Q2FI69 Staphylococcus aureus (strain USA300) TrEMBL   Pseudouridine synthase
tr|Q2FZQ6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Pseudouridine synthase
tr|Q5HH77 Staphylococcus aureus (strain COL) TrEMBL   Pseudouridine synthase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
13 fig|426430.8.peg.946 Adenylate cyclase (EC 4.6.1.1)
12 fig|426430.8.peg.948 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
14 fig|426430.8.peg.949 NAD kinase (EC 2.7.1.23)
5 fig|426430.8.peg.954 UPF0118 membrane protein SAV1012


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search