The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.713: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
Translate Function Assignments



Context on contig NC_009641 from base 734957 to 748432 (13476 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
707 734957 736630 1674 +       3: 2 5 1   Transport ATP-binding protein CydC locus|NWMN_0654, protein_id|YP_001331688.1, gi|151220866, geneID|5330369
708 737200 736757 444 - 126       dlit(15292128)
dlit(12730173)
dlit(15774883)
dlit(15731040)
dlit(12813062)
Transcriptional regulator MgrA (Regulator of autolytic activity) locus|NWMN_0655, protein_id|YP_001331689.1, gi|151220867, geneID|5330370
709 737427 738353 927 + 226     2: 6 7   Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family locus|NWMN_0656, protein_id|YP_001331690.1, gi|151220868, geneID|5330371
710 738456 739364 909 + 102         FIG01108122: hypothetical protein locus|NWMN_0657, protein_id|YP_001331691.1, gi|151220869, geneID|5330372
711 739399 739686 288 + 34         FIG01107862: hypothetical protein locus|NWMN_0658, protein_id|YP_001331692.1, gi|151220870, geneID|5330373
712 739969 741522 1554 + 282         Sodium/di- and tricarboxylate cotransporter locus|NWMN_0659, protein_id|YP_001331693.1, gi|151220871, geneID|5330374
713 741608 742981 1374 + 85     4: 3 8 11 12   Deoxyribodipyrimidine photolyase (EC 4.1.99.3) locus|NWMN_0660, protein_id|YP_001331694.1, gi|151220872, geneID|5330375
714 743483 743136 348 - 154         FIG01108118: hypothetical protein locus|NWMN_0661, protein_id|YP_001331695.1, gi|151220873, geneID|5330376
715 744034 743417 618 - -67         FIG01108543: hypothetical protein locus|NWMN_0662, protein_id|YP_001331696.1, gi|151220874, geneID|5330377
716 744642 744220 423 - 185         FIG01108024: hypothetical protein locus|NWMN_0663, protein_id|YP_001331697.1, gi|151220875, geneID|5330378
717 744851 746017 1167 + 208       dlit(2174864) MFS-type transporter quinolone resistance protein NorA gene_name|norA, locus|NWMN_0664, protein_id|YP_001331698.1, gi|151220876, geneID|5330379
718 746310 746762 453 + 292         FIG01108521: hypothetical protein locus|NWMN_0665, protein_id|YP_001331699.1, gi|151220877, geneID|5332207
719 746936 747418 483 + 173     3: 10 4 9   Cys-tRNA(Pro) deacylase YbaK locus|NWMN_0666, protein_id|YP_001331700.1, gi|151220878, geneID|5330380
720 747671 748432 762 + 252         Transcriptional repressor of the fructose operon, DeoR family locus|NWMN_0667, protein_id|YP_001331701.1, gi|151220879, geneID|5330381

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA_repair,_bacterial_photolyase gjo Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
COG0327 Harrison_Katherine_user Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
EC699-706 RossO Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
COG0327_DUF34 vcrecy Deoxyribodipyrimidine photolyase (EC 4.1.99.3)


  Protein Sequence

>fig|426430.8.peg.713 Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSASDLKAQFYRGTLQRFY
QSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEYDILHQRSLFNEARIAV
TLIRGNHYFKASKTMNQQGEPYNVFTSFYKKWRPYLRHRDVYHYDLKSFEDFVIASPDDL
VFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTSQLSVALAYGLLDIIEIFN
DLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAFKPKYRQIKWSQNEADFNAW
CEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLFIDWTWGEKFFRKHLIDYDAA
SNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYIKTYLPIFNQIDAKYLHDTQRN
ESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD

MD5 = ae5f2d004e752a777f7cc8723cf8c5e1


  DNA Sequence

>fig|426430.8.peg.713 Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
atggcaattgctgtgttattaaatcgaatgtttcgaatggaacacaatccattatttgaa
tatatttatcaacaaaaagaagacattgatgcatgttattttatcattccggaagaggac
atgtcttcagcttctgatttgaaagcacagttttatcgcggtactttgcagcgcttttac
caatcgttgcacgcagaaaagcttacaccttatgttatgtcttatgacgatatcatttca
ttttgtaaagaaaacaatatctctgaagtagtgactgcgggtgatattatgagttatcat
cttgaagaatatgatattttacatcaacgttctttattcaatgaagcacgcattgccgtt
actttgatacgtgggaatcattactttaaagcgagtaaaacaatgaatcaacaaggggag
ccatacaatgtttttactagtttctataaaaaatggcgaccttacttgaggcatagagac
gtatatcactatgatttaaaatcattcgaagactttgtcattgcatcacctgatgattta
gtgtttgatgacatagcatttggatcctcacaaataattgaacagaataaatggcaacat
tttttagatcaagatatacagaattacgaaagcggaagagactatttacctgaagtatta
acaagtcagctaagtgttgctttagcatatggattattagatattattgaaatttttaat
gatttattggcgcgttatgatgaagatgaggcaaactatgaagcatttatacgtgaactc
atttttagagaattttattatgtgttaatgacacagtatcctgaaacctcataccaagct
ttcaaacctaaatatcgacagataaaatggtcgcaaaatgaagcggattttaatgcatgg
tgcgaagggcaaacaggatttccaatcattgatgcagcaataatggaattgacacaaact
ggttttatgcataatcgaatgagaatggttgtgtcgcaatttttaaccaaagatttattt
atagattggacatggggagaaaaattctttagaaagcaccttattgactatgatgcagca
tcaaatattcatggatggcaatggtctgcttctacaggtacggatgcagtgccgtatttt
agaatgtttaatccaataagacagagtgaacgctttgatgctaaagctttgtatatcaaa
acatatcttccgatttttaatcaaattgatgcaaaatatttgcatgatacacaacgcaat
gagtccaacctttttgaacaggggattgaattaggtagtcattatccaagacaaatggta
gatcatcaagaaaaacgtacacaagttttagctacatttaaagcgctagactaa


  DNA with Flanking Sequence

>fig|426430.8.peg.713 Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
tcttttgaaaacaggtgcagctcaatggttaagtgatcaaacttttggtgttttaggttt
aaaacatttacctattatcgcgacaattgcacttatcacgctttttaatatattgattca
tttgggctttgcgagtgcaacaagtttatcatcagcgttaatacctgtttttatttcgct
aacctctacgttacacttaggagaccagtctataggatttgttttaattcaacaatttgt
tattagttttggtttcttattacctgttagtgcacctcaaaatatgttggcttatggcac
tggtacttttacggttaaagatttcttgaaggcaggtataccattgacaattgtagggta
tattctagtgatagtttttagcatgacttattggaaatggttaggtttgctttaattaaa
aatataaataagaatctaggttattttaaagtgacaaaaagcttaataaaataaaaagat
aattgaagggtgttttgtttatggcaattgctgtgttattaaatcgaatgtttcgaatgg
aacacaatccattatttgaatatatttatcaacaaaaagaagacattgatgcatgttatt
ttatcattccggaagaggacatgtcttcagcttctgatttgaaagcacagttttatcgcg
gtactttgcagcgcttttaccaatcgttgcacgcagaaaagcttacaccttatgttatgt
cttatgacgatatcatttcattttgtaaagaaaacaatatctctgaagtagtgactgcgg
gtgatattatgagttatcatcttgaagaatatgatattttacatcaacgttctttattca
atgaagcacgcattgccgttactttgatacgtgggaatcattactttaaagcgagtaaaa
caatgaatcaacaaggggagccatacaatgtttttactagtttctataaaaaatggcgac
cttacttgaggcatagagacgtatatcactatgatttaaaatcattcgaagactttgtca
ttgcatcacctgatgatttagtgtttgatgacatagcatttggatcctcacaaataattg
aacagaataaatggcaacattttttagatcaagatatacagaattacgaaagcggaagag
actatttacctgaagtattaacaagtcagctaagtgttgctttagcatatggattattag
atattattgaaatttttaatgatttattggcgcgttatgatgaagatgaggcaaactatg
aagcatttatacgtgaactcatttttagagaattttattatgtgttaatgacacagtatc
ctgaaacctcataccaagctttcaaacctaaatatcgacagataaaatggtcgcaaaatg
aagcggattttaatgcatggtgcgaagggcaaacaggatttccaatcattgatgcagcaa
taatggaattgacacaaactggttttatgcataatcgaatgagaatggttgtgtcgcaat
ttttaaccaaagatttatttatagattggacatggggagaaaaattctttagaaagcacc
ttattgactatgatgcagcatcaaatattcatggatggcaatggtctgcttctacaggta
cggatgcagtgccgtattttagaatgtttaatccaataagacagagtgaacgctttgatg
ctaaagctttgtatatcaaaacatatcttccgatttttaatcaaattgatgcaaaatatt
tgcatgatacacaacgcaatgagtccaacctttttgaacaggggattgaattaggtagtc
attatccaagacaaatggtagatcatcaagaaaaacgtacacaagttttagctacattta
aagcgctagactaattcggctcaattgatagatctggcatgagtaaaatctggagcagaa
tataaagttcttaagcaatataaataagccaatttctattattgatgtgatagaaattgg
ctttcctcaaatatataagttgtatttagttttcttattaatttgatgttatcttagtat
gtccgtaaataaagtgaggtatagtacgacatactctaaaaacgtagcgagataaatata
tttcaatctaacttttatgttttgaggcacttgccatttaggatattgtcgttcgtaata
cgacacttgttgtataaatacacctagtccaaatggcagcatcatgagtaagatacttct
taaataacttaaaccaatatcatgccatatgtgtccaataatcaattgaaagacaatgat
agatactattaaaacgattatatttattgtcacttgttcaaacgcactccttttccaaat
aatagaattgctgcttgcatgacaaccataaaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003904       F:deoxyribodipyrimidine photo-lyase activity
GO:0003913       F:DNA photolyase activity
GO:0006281       P:DNA repair
cmr|SACOL0751 Staphylococcus aureus subsp. aureus COL     deoxyribodipyrimidine photolyase, putative
cmr|SAUSA300_0677 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative deoxyribodipyrimidine photolyase
dbj|BAF66932.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1476 Staphylococcus aureus subsp. aureus USA300 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|426430.6.peg.649 Staphylococcus aureus subsp. aureus str. Newman FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|451515.3.peg.751 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|451516.9.peg.755 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|455227.3.peg.318 Staphylococcus aureus D30 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|546342.3.peg.2345 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|546343.3.peg.921 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|553567.3.peg.2397 Staphylococcus aureus A5948 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|553590.4.peg.1429 Staphylococcus aureus A9754 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|553594.3.peg.993 Staphylococcus aureus A9765 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|644279.4.peg.776 Staphylococcus aureus subsp. aureus 132 FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|93062.19.peg.730 Staphylococcus aureus subsp. aureus COL FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
fig|93062.4.peg.242 Staphylococcus aureus subsp. aureus COL FIG   Deoxyribodipyrimidine photolyase (EC 4.1.99.3)
gb|AAW37812.1 Staphylococcus aureus subsp. aureus COL     deoxyribodipyrimidine photolyase, putative
gb|ABD22297.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative deoxyribodipyrimidine photolyase
gb|ABX28735.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible deoxyribodipyrimidine photo-lyase
gb|EEV82264.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW48072.1 Staphylococcus aureus D30     hypothetical protein SAD30_2154
gi|150373672 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220872 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0660
gi|160367764 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible deoxyribodipyrimidine photo-lyase
gi|161508955 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   deoxyribodipyrimidine photo-lyase
gi|221139294 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   deoxyribodipyrimidine photo-lyase
gi|221140907 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   deoxyribodipyrimidine photo-lyase
gi|257859410 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452899 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259163515 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2154
gi|57285718 Staphylococcus aureus subsp. aureus COL NCBI   deoxyribodipyrimidine photolyase, putative
gi|57651532 Staphylococcus aureus subsp. aureus COL NCBI   deoxyribodipyrimidine photolyase, putative
gi|87127783 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative deoxyribodipyrimidine photolyase
gi|87161809 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative deoxyribodipyrimidine photolyase
img|637151526 Staphylococcus aureus aureus COL IMG   deoxyribodipyrimidine photolyase, putative
img|637887331 Staphylococcus aureus aureus USA300 IMG   putative deoxyribodipyrimidine photolyase
img|640795036 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308681 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible deoxyribodipyrimidine photo-lyase( EC:4.1.99.3 )
img|641772314 Staphylococcus aureus aureus USA300_TCH959 IMG   possible deoxyribodipyrimidine photo-lyase
kegg|saa:SAUSA300_0677 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative deoxyribodipyrimidine photolyase
kegg|sac:SACOL0751 Staphylococcus aureus subsp. aureus COL KEGG   deoxyribodipyrimidine photolyase, putative
kegg|sae:NWMN_0660 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sax:USA300HOU_0714 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   deoxyribodipyrimidine photo-lyase (EC:4.1.99.3)
ref|YP_001331694.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0660
ref|YP_001574614.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   deoxyribodipyrimidine photo-lyase
ref|YP_185630.1 Staphylococcus aureus subsp. aureus COL RefSeq   deoxyribodipyrimidine photolyase, putative
ref|YP_493380.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative deoxyribodipyrimidine photolyase
ref|ZP_03564094.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   deoxyribodipyrimidine photo-lyase
ref|ZP_03565400.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   deoxyribodipyrimidine photo-lyase
ref|ZP_05700893.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QF00 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YZW2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible deoxyribodipyrimidine photo-lyase
tr|Q2FIU8 Staphylococcus aureus (strain USA300) TrEMBL   Putative deoxyribodipyrimidine photolyase
tr|Q5HHX7 Staphylococcus aureus (strain COL) TrEMBL   Deoxyribodipyrimidine photolyase, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search