The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.582: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Phosphoglycolate phosphatase (EC 3.1.3.18)
Translate Function Assignments



Context on contig NC_009641 from base 614434 to 626494 (12061 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
575 615924 614434 1491 -       2: 46 25   Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52) locus|NWMN_0527, protein_id|YP_001331561.1, gi|151220739, geneID|5330276
576 617084 616206 879 - 281     26: 54 37 44 56 57 51 12 34 31 40 22 26 17 41 47 53 27 23 45 5 42 29 33 36 18 24   GTP cyclohydrolase I (EC 3.5.4.16) type 2 locus|NWMN_0529, protein_id|YP_001331563.1, gi|151220741, geneID|5330278
577 617762 617097 666 - 12     1: 4   FIG013761: LmbE family protein locus|NWMN_0530, protein_id|YP_001331564.1, gi|151220742, geneID|5330279
578 618135 617776 360 - 13     1: 4   FIG011895: hypothetical protein locus|NWMN_0531, protein_id|YP_001331565.1, gi|151220743, geneID|5330280
579 618414 619172 759 + 278     4: 7 39 16 1   Glucosamine-6-phosphate deaminase (EC 3.5.99.6) locus|NWMN_0532, protein_id|YP_001331566.1, gi|151220744, geneID|5330281
580 619249 619881 633 + 76     1: 1   D-arabino-3-hexulose 6-phosphate formaldehyde-lyase (EC 4.1.2.43) locus|NWMN_0533, protein_id|YP_001331567.1, gi|151220745, geneID|5330282
581 619883 620431 549 + 1     1: 1   6-phospho-3-hexuloisomerase (EC 5.3.1.27) locus|NWMN_0534, protein_id|YP_001331568.1, gi|151220746, geneID|5330283
582 620544 621191 648 + 112     2: 38 32   Phosphoglycolate phosphatase (EC 3.1.3.18) locus|NWMN_0535, protein_id|YP_001331569.1, gi|151220747, geneID|5330284
583 621693 623093 1401 + 501     2: 30 35   L-Proline/Glycine betaine transporter ProP locus|NWMN_0536, protein_id|YP_001331570.1, gi|151220748, geneID|5330285
584 623344 623637 294 + 250         FIG01108324: hypothetical protein locus|NWMN_0537, protein_id|YP_001331571.1, gi|151220749, geneID|5330286
585 623637 625013 1377 + -1     7: 28 9 21 2 3 49 52   Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) gene_name|vraA, locus|NWMN_0538, protein_id|YP_001331572.1, gi|151220750, geneID|5330287
586 625015 626154 1140 + 1     15: 11 2 14 48 55 13 15 50 8 6 43 19 3 10 20   3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9) gene_name|vraB, locus|NWMN_0539, protein_id|YP_001331573.1, gi|151220751, geneID|5332595
587 626129 626494 366 + -26         FIG01108173: hypothetical protein gene_name|vraC, locus|NWMN_0540, protein_id|YP_001331574.1, gi|151220752, geneID|5332596

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
2-phosphoglycolate_salvage gjo Phosphoglycolate phosphatase (EC 3.1.3.18)
Glycolate,_glyoxylate_interconversions SvetaG Phosphoglycolate phosphatase (EC 3.1.3.18)


  Protein Sequence

>fig|426430.8.peg.582 Phosphoglycolate phosphatase (EC 3.1.3.18)
MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKLADR
PLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVLERN
LSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQRAG
MQSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL

MD5 = 8056f9c97b8a87c3363a63a2dc693919


  DNA Sequence

>fig|426430.8.peg.582 Phosphoglycolate phosphatase (EC 3.1.3.18)
ttgaagtttgacaattatatttttgattttgatggtacgttggcagacacgaaaaaatgt
ggtgaagtagcaacacaaagtgcatttaaagcatgtggcttaacggaaccatcatctaaa
gaaataacgcattatatgggaatacctattgaagaatcatttttaaaattagcagaccga
ccattagatgaagcagcattagcaaagttaatcgatacatttagacatacatatcaatct
attgaaaaggactatatttatgaatttgcgggtataactgaagccattacaagtttgtat
aaccaagggaaaaaacttttcgtggtgtctagtaagaagagtgatgtattagaaagaaat
ttatcggctattggattaaatcacttgattaccgaagctgttggatccgatcaagtaagt
gcatataaaccaaatcctgaaggcatacacacaattgtgcaacgctacaatttaaatagc
caacaaacggtgtatattggtgattcaacgtttgatgttgagatggcacaacgtgctggt
atgcaatctgcagctgtcacttggggtgcacatgatgcaaggtcattacttcattcaaat
ccggattttattattaatgatccatcagaaattaataccgtattataa


  DNA with Flanking Sequence

>fig|426430.8.peg.582 Phosphoglycolate phosphatase (EC 3.1.3.18)
tgcaatgcgcttaaatcagctcggcaaacaggcacatgttgttggagaatcaacgacacc
tgcgattaagtcgaatgatgtatttgtaattatctctggttcaggttccacggaacattt
aagattattagcagacaaagcaaaatcagtaggtgctgacatcgtattaattactacaaa
taaagattctgcaataggcaatctagctgggacgaacatcgttttgcctgcaggtacaaa
atatgatgaacaaggctcggcacaaccattaggaagtttgtttgaacaagcatctcaatt
atttttagatagtgttgtaatgggattgatgactgaaatgaatgttacggaacaaacgat
gcaacaaaatcatgctaatttagaataaaataaagatagtcgataatatgatgcctaggc
agaaatattatcgattatttttttatttaaataataaattatagtataatatcaataata
aacgaataggggtgttaatattgaagtttgacaattatatttttgattttgatggtacgt
tggcagacacgaaaaaatgtggtgaagtagcaacacaaagtgcatttaaagcatgtggct
taacggaaccatcatctaaagaaataacgcattatatgggaatacctattgaagaatcat
ttttaaaattagcagaccgaccattagatgaagcagcattagcaaagttaatcgatacat
ttagacatacatatcaatctattgaaaaggactatatttatgaatttgcgggtataactg
aagccattacaagtttgtataaccaagggaaaaaacttttcgtggtgtctagtaagaaga
gtgatgtattagaaagaaatttatcggctattggattaaatcacttgattaccgaagctg
ttggatccgatcaagtaagtgcatataaaccaaatcctgaaggcatacacacaattgtgc
aacgctacaatttaaatagccaacaaacggtgtatattggtgattcaacgtttgatgttg
agatggcacaacgtgctggtatgcaatctgcagctgtcacttggggtgcacatgatgcaa
ggtcattacttcattcaaatccggattttattattaatgatccatcagaaattaataccg
tattataaaacttgttaaaacagagaataccatggttaaaatgcatattcataaatatta
gattatacttagaaatatttcgctttagattaggaatttaaaataaatatttattaaaca
ttatgaatttttaaagagtaatgtctgactcgttgataatttatttttgtaaaaataaat
taaagtaatgacaaagttattgaagtaaattgagtataaacatttaaatacgatgtcgaa
aatggcgatagcatatcacttacatgaagttgtgtgctatcgctatttttagttataatt
ccaaaaagttaatcgttcgatgatttaagaattattattgtttaattcaaatgtatgagg
gtataaaatcattgaatttaattcgataaagcgaaatttttgaacaaacatacttttgta
tttatataaaagtttaaattcttataaatttgacaaaactaattaactccgtataattat
gaaacatacaagagggagtgtatgaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008152       P:metabolic process
GO:0008967       F:phosphoglycolate phosphatase activity
cmr|NT05SA0504 Staphylococcus aureus NCTC 8325     HAD-superfamily hydrolase, subfamily IA, variant 1
cmr|SAUSA300_0557 Staphylococcus aureus subsp. aureus USA300-FPR3757     HAD-superfamily hydrolase, subfamily IA, variant 1
fig|367830.3.peg.637 Staphylococcus aureus subsp. aureus USA300 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|451515.3.peg.620 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|451516.9.peg.610 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|452948.4.peg.1005 Staphylococcus aureus 930918-3 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|455227.3.peg.1701 Staphylococcus aureus D30 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|546342.3.peg.2229 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|546343.3.peg.1915 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|553567.3.peg.469 Staphylococcus aureus A5948 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|553590.4.peg.1283 Staphylococcus aureus A9754 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|553594.3.peg.2180 Staphylococcus aureus A9765 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|644279.4.peg.646 Staphylococcus aureus subsp. aureus 132 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|93061.3.peg.541 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|93061.5.peg.500 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
fig|93062.19.peg.602 Staphylococcus aureus subsp. aureus COL FIG   Phosphoglycolate phosphatase (EC 3.1.3.18)
gb|ABD22809.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     HAD-superfamily hydrolase, subfamily IA, variant 1
gb|ABD29702.1 Staphylococcus aureus subsp. aureus NCTC 8325     hydrolase, haloacid dehalogenase-like
gb|ABX28592.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible phosphatase
gb|EEW45196.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1248
gb|EEW46785.1 Staphylococcus aureus D30     hypothetical protein SAD30_1128
gi|160367621 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible phosphatase
gi|161508812 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   phosphatase
gi|221139183 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_11155
gi|221141863 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_09570
gi|259160166 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1248
gi|259162210 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1128
gi|87128295 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   HAD-superfamily hydrolase, subfamily IA, variant 1
gi|87162321 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   HAD family hydrolase
gi|87201892 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hydrolase, haloacid dehalogenase-like
gi|88194334 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hydrolase, haloacid dehalogenase-like
img|637887211 Staphylococcus aureus aureus USA300 IMG   HAD-superfamily hydrolase, subfamily IA, variant 1
img|637893217 Staphylococcus aureus aureus NCTC 8325 IMG   hydrolase, haloacid dehalogenase-like
img|641308538 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible phosphatase( EC:3.1.3.- )
img|641772213 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0557 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   HAD family hydrolase
kegg|sao:SAOUHSC_00555 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hydrolase, haloacid dehalogenase-like
kegg|sax:USA300HOU_0566 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   phosphatase (EC:3.1.3.-)
ref|YP_001574471.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   phosphatase
ref|YP_493260.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   HAD family hydrolase
ref|YP_499127.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hydrolase, haloacid dehalogenase-like
ref|ZP_03563983.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_11155
ref|ZP_03566356.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_09570
tr|A8YZS0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible phosphatase
tr|Q2FJ68 Staphylococcus aureus (strain USA300) TrEMBL   HAD-superfamily hydrolase, subfamily IA, variant 1
tr|Q2G0K5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Hydrolase, haloacid dehalogenase-like


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search