The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.571: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Adhesin of unknown specificity SdrC
Translate Function Assignments



Context on contig NC_009641 from base 595701 to 612719 (17019 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
563 595701 596777 1077 +       11: 15 7 13 5 6 4 10 14 11 16 9   Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|NWMN_0516, protein_id|YP_001331550.1, gi|151220728, geneID|5331798
564 596807 596923 117 + 29         FIG01108699: hypothetical protein  
565 597027 597710 684 + 103         Hydrolase, haloacid dehalogenase-like family locus|NWMN_0517, protein_id|YP_001331551.1, gi|151220729, geneID|5332041
566 598488 597826 663 - 115     2: 3 2   Deoxyadenosine kinase (EC 2.7.1.76) / Deoxyguanosine kinase (EC 2.7.1.113) locus|NWMN_0518, protein_id|YP_001331552.1, gi|151220730, geneID|5330270
567 599098 598481 618 - -8     2: 3 2   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG locus|NWMN_0519, protein_id|YP_001331553.1, gi|151220731, geneID|5330271
568 599165 599635 471 + 66     2: 8 12   tRNA adenosine(34) deaminase (EC 3.5.4.33) locus|NWMN_0520, protein_id|YP_001331554.1, gi|151220732, geneID|5330272
569 599782 600651 870 + 146         Hydrolase (HAD superfamily) locus|NWMN_0521, protein_id|YP_001331555.1, gi|151220733, geneID|5330273
570 600672 601238 567 + 20       dlit(15870453) Predicted flavoprotein locus|NWMN_0522, protein_id|YP_001331556.1, gi|151220734, geneID|5330274
571 601668 604511 2844 + 429     1: 1   Adhesin of unknown specificity SdrC gene_name|sdrC, locus|NWMN_0523, protein_id|YP_001331557.1, gi|151220735, geneID|5330275
572 604878 608825 3948 + 366     1: 1   Adhesin of unknown specificity SdrD gene_name|sdrD, locus|NWMN_0524, protein_id|YP_001331558.1, gi|151220736, geneID|5332462
573 609219 612719 3501 + 393     1: 1   Adhesin of unknown specificity SdrE, similar to bone sialoprotein-binding protein Bbp gene_name|sdrE, locus|NWMN_0525, protein_id|YP_001331559.1, gi|151220737, geneID|5332463

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Adhesins_in_Staphylococcus SvetaG Adhesin of unknown specificity SdrC


  Protein Sequence

>fig|426430.8.peg.571 Adhesin of unknown specificity SdrC
MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSGHEAKAAEHTNGELNQ
SKNETTAPSENKTTKKVDSRQLKDNTQTATADQPKVTMSDSATVKETSSNMQSPQNATAN
QSTTKTSNVTTNDKSSTTYSNETDKSNLTQAKDVSTTPKTTTIKPRTLNRMAVNTVAAPQ
QGTNVNDKVHFSNIDIAIDKGHVNQTTGKTEFWATSSDVLKLKANYTIDDSVKEGDTFTF
KYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTTYTFTNYVDQYTNVRGSFEQ
VAFAKRKNATTDKTAYKMEVTLGNDTYSEEIIVDYGNKKAQPLISSTNYINNEDLSRNMT
AYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQNQFVDSFTPDTSKLKDVTDQF
DVIYSNDNKTATVDLMKGQTSSNKQYIIQQVAYPDNSSTDNGKIDYTLDTDKTKYSWSNS
YSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANEKGIKGVYVILKDSNGKELDRTTT
DENGKYQFTGLSNGTYSVEFSTPAGYTPTTANVGTDDAVDSDGLTTTGVIKDADNMTLDS
GFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVKVTLQNEKGEVIGTTETDENGKYRFD
NLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTITDHDDFTLDNGYYEEETSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDNDSDSDSDSDSDAGKHTPAKPMSTV
KDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK

MD5 = ca87e40f90bc564310bf03017f3e7073


  DNA Sequence

>fig|426430.8.peg.571 Adhesin of unknown specificity SdrC
atgaataataaaaagacagcaacaaatagaaaaggcatgataccaaatcgattaaacaaa
ttttcgataagaaagtattctgtaggtactgcttcaattttagtagggacaacattgatt
tttgggttaagtggtcatgaagctaaagcggcagaacatacgaatggagaattaaatcaa
tcaaaaaatgaaacgacagccccaagtgagaataaaacaactaaaaaagttgatagtcgt
caactaaaagacaatacgcaaactgcaactgcagatcagcctaaagtgacaatgagtgat
agtgcaacagttaaagaaactagtagtaacatgcaatcaccacaaaacgctacagctaat
caatctactacaaaaactagcaatgtaacaacaaatgataaatcatcaactacatatagt
aatgaaactgataaaagtaatttaacacaagcaaaagatgtttcaactacacctaaaaca
acgactattaaaccaagaactttaaatcgcatggcagtgaatactgttgcagctccacaa
caaggaacaaatgttaatgataaagtacatttttcaaatattgacattgcgattgataaa
ggacatgttaatcagactactggtaaaactgaattttgggcaacttcaagtgatgtttta
aaattaaaagcaaattacacaatcgatgattctgttaaagagggcgatacatttactttt
aaatatggtcaatatttccgtccaggatcagtaagattaccttcacaaactcaaaattta
tataatgcccaaggtaatattattgcaaaaggtatttatgatagtacaacaaacacaaca
acatatacttttacgaactatgtagatcaatatacaaatgttagaggtagctttgaacaa
gttgcatttgcgaaacgtaaaaatgcaacaactgataaaacagcttataaaatggaagta
actttaggtaatgatacatatagcgaagaaatcattgtcgattatggtaataaaaaagca
caaccgcttatttcaagtacaaactatattaacaatgaagatttatcgcgtaatatgact
gcatatgtaaatcaacctaaaaatacatatactaaacaaacgtttgttactaatttaact
ggatataaatttaatccaaatgcaaaaaacttcaaaatttacgaagtgacagatcaaaat
caatttgtggatagtttcacccctgatacttcaaaacttaaagatgttactgatcaattc
gatgttatttatagtaatgataataaaacagctacagtcgatttaatgaaaggccaaaca
agcagcaataaacaatacatcattcaacaagttgcttatccagataatagttcaacagat
aatggaaaaattgattatactttagacactgacaaaactaaatatagttggtcaaatagt
tattcaaatgtgaatggctcatcaactgctaatggcgaccaaaagaaatataatctaggt
gactatgtatgggaagatacaaataaagatggtaaacaagatgccaatgaaaaagggatt
aaaggtgtttatgtcattcttaaagatagtaacggtaaagaattagatcgtacgacaaca
gatgaaaatggtaaatatcagttcactggtttaagcaatggaacttatagtgtagagttt
tcaacaccagccggttatacaccgacaactgcaaatgtaggtacagatgatgctgtagat
tctgatggactaactacaacaggtgtcattaaagacgctgacaacatgacattagatagt
ggattctacaaaacaccaaaatatagtttaggtgattatgtttggtacgacagtaataaa
gatggtaaacaagattcgactgaaaaaggaattaaaggtgttaaagttactttgcaaaac
gaaaaaggcgaagtaattggtacaactgaaacagatgaaaatggtaaataccgctttgat
aatttagatagtggtaaatacaaagttatctttgaaaaacctgctggcttaactcaaaca
ggtacaaatacaactgaagatgataaagatgccgatggtggcgaagttgatgtaacaatt
acggatcatgatgatttcacacttgataatggctactacgaagaagaaacatcagatagc
gactcagattctgacagcgattcagactcagatagcgactcagattcagatagcgactca
gattcagacagcgattcagacagcgactcagactcagatagcgattcagattcagacagc
gactcagactcagacagcaattcagactcggatagcgactcagactcagatagcgactca
gattcggatagcgactcagactcagatagcgattcagattcagatagcgattcggactca
gacagtgattcagattcagactcagatagcgactcagattctgacagcgattcagactca
gacagcgactcagactcagacagtgattcagattcagacagcgactcagattcagatagc
gactcagactcagatagcgactcagactcagatagcgactcagactcggatagcgattca
gattcagacagcgactcagattcagatagcgattcggactcagacaacgactcagattca
gatagcgattcagattcagatgcaggtaaacatactccggctaaaccaatgagtacggtt
aaagatcagcataaaacagctaaagcattaccagaaacaggtagtgaaaataataattca
aataatggcacattattcggtggattattcgcggcattaggatcattattgttattcggt
cgtcgtaaaaaacaaaataaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.571 Adhesin of unknown specificity SdrC
tacgagcaagattatttgtcgatcaaattgtatcttttgtgaataatagtccatatgaac
atttaaaataatattaaaaaatatgtaaatatacattaaaaataggtatgtagcttaagg
tatttcattgagaatgcttttaagtcacatgcctattttttgttctaatgcaccaatagt
aagcctttgatattactgttgtgagcaatgttattaattaaaataagatgtaatagcgaa
ttgaaaacaagcttagattaaaagtgagttttaaaaatatagataaataatttaaagcaa
ttaaagaaaaaagtattaaaaattgcaattcttaaactgtgattcatattaatatttcta
gcaaataacattgtaaaataaagaaaaataattaaagtattgcactttattgaaatttat
attacgatagtaatgcagaaatttatatatgcaaaatattatatttatcaaattttgata
ttttaaaggagtattattaaatgaataataaaaagacagcaacaaatagaaaaggcatga
taccaaatcgattaaacaaattttcgataagaaagtattctgtaggtactgcttcaattt
tagtagggacaacattgatttttgggttaagtggtcatgaagctaaagcggcagaacata
cgaatggagaattaaatcaatcaaaaaatgaaacgacagccccaagtgagaataaaacaa
ctaaaaaagttgatagtcgtcaactaaaagacaatacgcaaactgcaactgcagatcagc
ctaaagtgacaatgagtgatagtgcaacagttaaagaaactagtagtaacatgcaatcac
cacaaaacgctacagctaatcaatctactacaaaaactagcaatgtaacaacaaatgata
aatcatcaactacatatagtaatgaaactgataaaagtaatttaacacaagcaaaagatg
tttcaactacacctaaaacaacgactattaaaccaagaactttaaatcgcatggcagtga
atactgttgcagctccacaacaaggaacaaatgttaatgataaagtacatttttcaaata
ttgacattgcgattgataaaggacatgttaatcagactactggtaaaactgaattttggg
caacttcaagtgatgttttaaaattaaaagcaaattacacaatcgatgattctgttaaag
agggcgatacatttacttttaaatatggtcaatatttccgtccaggatcagtaagattac
cttcacaaactcaaaatttatataatgcccaaggtaatattattgcaaaaggtatttatg
atagtacaacaaacacaacaacatatacttttacgaactatgtagatcaatatacaaatg
ttagaggtagctttgaacaagttgcatttgcgaaacgtaaaaatgcaacaactgataaaa
cagcttataaaatggaagtaactttaggtaatgatacatatagcgaagaaatcattgtcg
attatggtaataaaaaagcacaaccgcttatttcaagtacaaactatattaacaatgaag
atttatcgcgtaatatgactgcatatgtaaatcaacctaaaaatacatatactaaacaaa
cgtttgttactaatttaactggatataaatttaatccaaatgcaaaaaacttcaaaattt
acgaagtgacagatcaaaatcaatttgtggatagtttcacccctgatacttcaaaactta
aagatgttactgatcaattcgatgttatttatagtaatgataataaaacagctacagtcg
atttaatgaaaggccaaacaagcagcaataaacaatacatcattcaacaagttgcttatc
cagataatagttcaacagataatggaaaaattgattatactttagacactgacaaaacta
aatatagttggtcaaatagttattcaaatgtgaatggctcatcaactgctaatggcgacc
aaaagaaatataatctaggtgactatgtatgggaagatacaaataaagatggtaaacaag
atgccaatgaaaaagggattaaaggtgtttatgtcattcttaaagatagtaacggtaaag
aattagatcgtacgacaacagatgaaaatggtaaatatcagttcactggtttaagcaatg
gaacttatagtgtagagttttcaacaccagccggttatacaccgacaactgcaaatgtag
gtacagatgatgctgtagattctgatggactaactacaacaggtgtcattaaagacgctg
acaacatgacattagatagtggattctacaaaacaccaaaatatagtttaggtgattatg
tttggtacgacagtaataaagatggtaaacaagattcgactgaaaaaggaattaaaggtg
ttaaagttactttgcaaaacgaaaaaggcgaagtaattggtacaactgaaacagatgaaa
atggtaaataccgctttgataatttagatagtggtaaatacaaagttatctttgaaaaac
ctgctggcttaactcaaacaggtacaaatacaactgaagatgataaagatgccgatggtg
gcgaagttgatgtaacaattacggatcatgatgatttcacacttgataatggctactacg
aagaagaaacatcagatagcgactcagattctgacagcgattcagactcagatagcgact
cagattcagatagcgactcagattcagacagcgattcagacagcgactcagactcagata
gcgattcagattcagacagcgactcagactcagacagcaattcagactcggatagcgact
cagactcagatagcgactcagattcggatagcgactcagactcagatagcgattcagatt
cagatagcgattcggactcagacagtgattcagattcagactcagatagcgactcagatt
ctgacagcgattcagactcagacagcgactcagactcagacagtgattcagattcagaca
gcgactcagattcagatagcgactcagactcagatagcgactcagactcagatagcgact
cagactcggatagcgattcagattcagacagcgactcagattcagatagcgattcggact
cagacaacgactcagattcagatagcgattcagattcagatgcaggtaaacatactccgg
ctaaaccaatgagtacggttaaagatcagcataaaacagctaaagcattaccagaaacag
gtagtgaaaataataattcaaataatggcacattattcggtggattattcgcggcattag
gatcattattgttattcggtcgtcgtaaaaaacaaaataaataatatgattaacttaacc
aggtccatgtggcctggttttttctgtttagaaattcccagatataaaacaaaaaatctt
taaggaatagatacaatttaatttgttacagaaatgtaattgtctatgaattagaaaagc
taagatattaatttcaagggcaaataatactattttttatgatgattaaataaagattac
aaaactcataaaaacttttatttaaacacaaatgttaaataacgttttacgataaagaaa
aataattaaagtattgtgctttatctaaaaatgtaatactatattgatatacatttttgt
atttaaaacaattgtattatttaaaaatttgatgaattaggagtaatctaatgctaaaca
gagaaaataaaacggcaataacaaggaaaggcatggtatccaatcgattaaataaatttt
cgattagaaagtacacagtgggaacagcatcaattttagtaggtacaacattaatttttg
gtct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005509       F:calcium ion binding
GO:0005515       F:protein binding
GO:0005576       C:extracellular region
GO:0005618       C:cell wall
GO:0007155       P:cell adhesion
GO:0009986       C:cell surface
GO:0016020       C:membrane
dbj|BAF66795.1 Staphylococcus aureus subsp. aureus str. Newman     Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
fig|426430.6.peg.524 Staphylococcus aureus subsp. aureus str. Newman FIG   Adhesin of unknown specificity SdrC
gi|150373535 Staphylococcus aureus subsp. aureus str. Newman NCBI   Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
gi|151220735 Staphylococcus aureus subsp. aureus str. Newman NCBI   Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
gi|166214978 organism not parsed/found in ncbi nr NCBI   RecName: Full=Serine-aspartate repeat-containing protein C; Flags: Precursor
img|640794899 Staphylococcus aureus aureus Newman IMG   Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
kegg|sae:NWMN_0523 Staphylococcus aureus subsp. aureus Newman KEGG   Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
ref|YP_001331557.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrC
sp|O86487 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=Serine-aspartate repeat-containing protein C; Flags: Precursor
sp|SDRC_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Serine-aspartate repeat-containing protein C; Flags: Precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search