The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.549: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: LSU ribosomal protein L7p/L12p (P1/P2)
Translate Function Assignments



Context on contig NC_009641 from base 569416 to 583388 (13973 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
540 569416 570162 747 +   7     23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) ## LSU rRNA Gm2251 locus|NWMN_0494, protein_id|YP_001331528.1, gi|151220706, geneID|5330261
541 570162 570686 525 + -1 7     Hypothetical protein DUF901, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins locus|NWMN_0495, protein_id|YP_001331529.1, gi|151220707, geneID|5330262
542 570767 571336 570 + 80     2: 9 11   RNA polymerase sporulation specific sigma factor SigH locus|NWMN_0496, protein_id|YP_001331530.1, gi|151220708, geneID|5330263
543 571451 571594 144 + 114 6 3: 3 2 8   LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent  
544 571650 571832 183 + 55 9 1: 1   Preprotein translocase subunit SecE (TC 3.A.5.1.1) gene_name|secE, locus|NWMN_0497, protein_id|YP_001331531.1, gi|151220709, geneID|5330264
545 571845 572393 549 + 12 57 2: 10 1   Transcription termination/antitermination protein NusG gene_name|nusG, locus|NWMN_0498, protein_id|YP_001331532.1, gi|151220710, geneID|5332469
546 572574 572996 423 + 180 33 5: 4 3 2 5 1   LSU ribosomal protein L11p (L12e) gene_name|rplK, locus|NWMN_0499, protein_id|YP_001331533.1, gi|151220711, geneID|5332215
547 573204 573896 693 + 207 47 6: 4 3 2 7 5 1   LSU ribosomal protein L1p (L10Ae) gene_name|rplA, locus|NWMN_0500, protein_id|YP_001331534.1, gi|151220712, geneID|5332374
548 574168 574668 501 + 271 53 4: 4 3 2 1   LSU ribosomal protein L10p (P0) gene_name|rplJ, locus|NWMN_0501, protein_id|YP_001331535.1, gi|151220713, geneID|5332366
549 574711 575079 369 + 42   5: 4 3 2 5 1   LSU ribosomal protein L7p/L12p (P1/P2) gene_name|rplL, locus|NWMN_0502, protein_id|YP_001331536.1, gi|151220714, geneID|5332373
550 575254 575862 609 + 174 7     16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC locus|NWMN_0503, protein_id|YP_001331537.1, gi|151220715, geneID|5332375
551 576077 579628 3552 + 214 10 2: 6 7   DNA-directed RNA polymerase beta subunit (EC 2.7.7.6) gene_name|rpoB, locus|NWMN_0504, protein_id|YP_001331538.1, gi|151220716, geneID|5330265
552 579765 583388 3624 + 136 28 1: 6 dlit(1402788)
dlit(7772603)
DNA-directed RNA polymerase beta' subunit (EC 2.7.7.6) gene_name|rpoC, locus|NWMN_0505, protein_id|YP_001331539.1, gi|151220717, geneID|5332400

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ribospme_LSU_Symbiont vcrecy LSU ribosomal protein L7/L12 (P1/P2)
LSU_ribosomal_proteins_cluster LSU ribosomal protein L7/L12 (P1/P2)
Ribosome_LSU_bacterial gjo LSU ribosomal protein L7/L12 (P1/P2)
Single-copy_ribosomal_proteins gjo LSU ribosomal protein L7/L12 (P1/P2)
PanGenomes_ForPhylogeny_Str Ravcheev_Dmitry_user LSU ribosomal protein L7p/L12p (P1/P2)


  Protein Sequence

>fig|426430.8.peg.549 LSU ribosomal protein L7p/L12p (P1/P2)
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
IK

MD5 = 4f6d6ba05a678e4b967938b186071e05


  DNA Sequence

>fig|426430.8.peg.549 LSU ribosomal protein L7p/L12p (P1/P2)
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ataaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.549 LSU ribosomal protein L7p/L12p (P1/P2)
ttgctgaggtactatcaaattcagtttcaacagtaatcgttgactaccgtggattaacag
tagctgaagttactgacttacgttcacaattacgtgaagctggtgttgagtataaagtat
acaaaaacactatggtacgtcgtgcagctgaaaaagctggtatcgaaggcttagatgaat
tcttaacaggtcctactgctattgcaacttcaagtgaagatgctgtagctgcagcgaaag
taatttctggatttgctaaagatcatgaagcattagaaattaaatcaggcgttatggaag
gcaatgttattacagcagaagaagttaaaactgttggttcattaccttcacacgatggtc
ttgtatctatgcttttatcagtattacaagctcctgtacgcaacttcgcttatgcggtta
aagctattggagaacaaaaagaagaaaacgctgaataatttttagcgtaaaaaaattaaa
aataatggaggaattataaaatggctaatcatgaacaaatcattgaagcgattaaagaaa
tgtcagtattagaattaaacgacttagtaaaagcaattgaagaagaatttggtgtaactg
cagctgctccagtagcagtagcaggtgcagctggtggcgctgacgctgcagcagaaaaaa
ctgaatttgacgttgagttaacttcagctggttcatctaaaatcaaagttgttaaagctg
ttaaagaagcaactggtttaggattaaaagatgctaaagaattagtagacggagctccta
aagtaatcaaagaagctttacctaaagaagaagctgaaaaacttaaagaacaattagaag
aagttggagctactgtagaaataaaataattcaagtatcttaaacttaataatcaaagtt
ttatagcaagtattgctataatataatgattctttgagaagttaaaaccccgttattttg
ataacggggttttattcatttaaagactgagtgaaatgttataattataatgacgagtta
caaagtgaagatgaggtggaataatgagtcattattacgatgaagatccaagtgtaatta
gcaatgaacaacgtattcaatatcaattaaaccatcataaaattgatttaataactgata
acggagtgttttcgaaagataaagtagattatggttcagatgttcttgttcaaacttttt
taaaagcgcatccacctggtccaagtaagcgaattgccgatgttggttgtggttacggac
caattggtttgatgattgctaaagtatcaccacatcattcaattacaatgctagatgtta
atcacagagcgctagccttagttgaaaaaaacaaaaaattaaatggtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
dbj|BAF66774.1 Staphylococcus aureus subsp. aureus str. Newman     50S ribosomal protein L7
fig|426430.6.peg.504 Staphylococcus aureus subsp. aureus str. Newman FIG   LSU ribosomal protein L7p/L12p (P1/P2)
gi|150373514 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L7
gi|151220714 Staphylococcus aureus subsp. aureus str. Newman NCBI   50S ribosomal protein L7/L12
gi|172048777 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L7/L12
img|640794878 Staphylococcus aureus aureus Newman IMG   50S ribosomal protein L7
kegg|sae:NWMN_0502 Staphylococcus aureus subsp. aureus Newman KEGG   50S ribosomal protein L7/L12
ref|YP_001331536.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   50S ribosomal protein L7/L12
sp|A6QEJ2 Staphylococcus aureus (strain Newman) SwissProt   50S ribosomal protein L7/L12
sp|RL7_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L7/L12


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|426430.8.peg.540 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) ## LSU rRNA Gm2251
7 fig|426430.8.peg.541 Hypothetical protein DUF901, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins
6 fig|426430.8.peg.543 LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent
9 fig|426430.8.peg.544 Preprotein translocase subunit SecE (TC 3.A.5.1.1)
57 fig|426430.8.peg.545 Transcription termination/antitermination protein NusG
33 fig|426430.8.peg.546 LSU ribosomal protein L11p (L12e)
47 fig|426430.8.peg.547 LSU ribosomal protein L1p (L10Ae)
53 fig|426430.8.peg.548 LSU ribosomal protein L10p (P0)
7 fig|426430.8.peg.550 16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC
10 fig|426430.8.peg.551 DNA-directed RNA polymerase beta subunit (EC 2.7.7.6)
28 fig|426430.8.peg.552 DNA-directed RNA polymerase beta' subunit (EC 2.7.7.6)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search