The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.48: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01107885: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 50358 to 63771 (13414 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
43 50358 53510 3153 +           Superfamily I DNA/RNA helicase protein locus|NWMN_0039, protein_id|YP_001331074.1, gi|151220251, geneID|5329944
44 53567 54049 483 + 56         FIG01108341: hypothetical protein locus|NWMN_0040, protein_id|YP_001331075.1, gi|151220252, geneID|5329945
45 54254 55240 987 + 204     1: 1   Phosphatidylinositol-specific phospholipase C (EC 4.6.1.13) locus|NWMN_0041, protein_id|YP_001331076.1, gi|151220253, geneID|5329946
46 55461 56231 771 + 220         FIG01107885: hypothetical protein locus|NWMN_0042, protein_id|YP_001331077.1, gi|151220254, geneID|5329947
47 56250 57053 804 + 18         FIG01107885: hypothetical protein locus|NWMN_0043, protein_id|YP_001331078.1, gi|151220255, geneID|5329948
48 57117 57887 771 + 63         FIG01107885: hypothetical protein locus|NWMN_0044, protein_id|YP_001331079.1, gi|151220256, geneID|5329949
49 57954 58721 768 + 66         FIG01107885: hypothetical protein locus|NWMN_0045, protein_id|YP_001331080.1, gi|151220257, geneID|5329950
50 58815 61052 2238 + 93         Transcriptional regulator, AraC family locus|NWMN_0046, protein_id|YP_001331081.1, gi|151220258, geneID|5329951
51 61203 62381 1179 + 150         Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A locus|NWMN_0047, protein_id|YP_001331082.1, gi|151220259, geneID|5329952
52 62383 63771 1389 + 1         putative transporter locus|NWMN_0048, protein_id|YP_001331083.1, gi|151220260, geneID|5329953

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.48 FIG01107885: hypothetical protein
MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRD
DEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQ
ENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVP
SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
NIYFSDGLIFKPSEDK

MD5 = 7deb65124f8a0b03d2e2a23d2a85de88


  DNA Sequence

>fig|426430.8.peg.48 FIG01107885: hypothetical protein
atgatgaaacgattaaacaaattagtgttaggcattatttttctgtttttagtcattagt
atcactgctggttgtggcataggtaaagaagcgaaaataaagaaaagttttgagaagaca
ttgagtatgtatccgattaaaaatctagaggatttatacgataaagaaggttatcgtgat
gacgaatttgataaaaatgataaaggtacatggattattggttctgaaatggcaactcaa
aataagggggaagctctgaaagttaaaggtatggtcttgtatatgaatagaaataccaaa
acaacaaaaggatattattatgtaaatgcaataaagaatgataaagacggaagaccccaa
gagaatgaaaaaaggtacccagttaaaatggtcgataataaaatcattccaacaaaagaa
attaaagataaaaacataaaaaaagaaatcgaaaactttaagttctttgttcaatatgga
aactttaaagatttgtcgaagtataaagacggagatatttcatataatccagaggtgccg
agttattcggctaaatatcaattaactaatgatgattacaatgtaaagcaattacgtaaa
agatatgacataccaacaaataaagcaccgaagttgttgttgaagggtacagggaattta
aaaggttcatcagttggatataaagacattgaatttacgtttgtagagaaaaaagaagag
aacatttactttagtgatgggttaatttttaaaccaagtgaggataaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.48 FIG01107885: hypothetical protein
agacggagaaatacgaagtagctcaggataatcaaaaaaaatatccagttaaaatgatta
ataataaattcatttctactgaggaagttaaagaagaaaacataaaaaaagaaatcgaaa
actttaagttttttgcgcaatatagcaattttaaagatttaatgaattataaagatggag
atatatcatataatccagaggtgccgagttattcagctcaatatcaattaactaatgatg
attataatgtaaaacaattacgtaaaagatatgacataccaacaaataaagcgccgaagc
tgttgttgaaaggtacagggaatttaaaaggttcatcagttggatataaaaaaattgaat
ttacttttttagagaataaaaatgaaaatatttactttactgatagtctacatcttgaac
cgagcgaggataaataatcatcttttaaccagaatatgaaatcaatctaggacaacctaa
taaaaggagagagttgtaagatgatgaaacgattaaacaaattagtgttaggcattattt
ttctgtttttagtcattagtatcactgctggttgtggcataggtaaagaagcgaaaataa
agaaaagttttgagaagacattgagtatgtatccgattaaaaatctagaggatttatacg
ataaagaaggttatcgtgatgacgaatttgataaaaatgataaaggtacatggattattg
gttctgaaatggcaactcaaaataagggggaagctctgaaagttaaaggtatggtcttgt
atatgaatagaaataccaaaacaacaaaaggatattattatgtaaatgcaataaagaatg
ataaagacggaagaccccaagagaatgaaaaaaggtacccagttaaaatggtcgataata
aaatcattccaacaaaagaaattaaagataaaaacataaaaaaagaaatcgaaaacttta
agttctttgttcaatatggaaactttaaagatttgtcgaagtataaagacggagatattt
catataatccagaggtgccgagttattcggctaaatatcaattaactaatgatgattaca
atgtaaagcaattacgtaaaagatatgacataccaacaaataaagcaccgaagttgttgt
tgaagggtacagggaatttaaaaggttcatcagttggatataaagacattgaatttacgt
ttgtagagaaaaaagaagagaacatttactttagtgatgggttaatttttaaaccaagtg
aggataaataatcatgactcgatcaaaatatgaaatcaatccaggaaagataataagaag
aataggattgtgaaattatgaaacgattaaacaaattggtattgtatattagttttttga
tattagtcattagtttcactgctggttgtggcataggtaaagaagcggaagttaagaaaa
gctttgaaaaaacattgagtatgtatccgattaaaaatctagaggatttatacgataaag
aaggttatcgtgatgacgaatttgataaaaatgataaaggtacatggattattggttctg
aaatggttgttcaacctaaaggggaacgtatgaaatcaaaaggtatggttctatatatga
atagaaacactaagactacaaccgggaagtatatagtgagtgaaacacttcatgatgaag
atggtagacctaagagtaaagataaagaatatcccgttaaaatggtagacaataaaatca
ttccaactaaaggtatcaaagacgaaaatat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
cmr|NT05SA0048 Staphylococcus aureus NCTC 8325     staphylococcal tandem lipoprotein
cmr|SAUSA300_0102 Staphylococcus aureus subsp. aureus USA300-FPR3757     staphylococcus tandem lipoprotein
dbj|BAF66316.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.902 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107885: hypothetical protein
fig|426430.6.peg.46 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107885: hypothetical protein
fig|451515.3.peg.154 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107885: hypothetical protein
fig|451516.9.peg.141 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107885: hypothetical protein
fig|553567.3.peg.1761 Staphylococcus aureus A5948 FIG   FIG01107885: hypothetical protein
fig|553590.4.peg.2751 Staphylococcus aureus A9754 FIG   FIG01107885: hypothetical protein
fig|553594.3.peg.1702 Staphylococcus aureus A9765 FIG   FIG01107885: hypothetical protein
fig|644279.4.peg.166 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107885: hypothetical protein
fig|93061.3.peg.3 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107885: hypothetical protein
fig|93061.5.peg.48 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107885: hypothetical protein
gb|ABD21057.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     staphylococcal tandem lipoprotein
gb|ABD29242.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28148.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible staphylococcal tandem lipoprotein
gb|EEV82917.1 Staphylococcus aureus A5948     staphylococcal tandem lipoprotein
gi|150373056 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220256 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0044
gi|160367177 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible staphylococcal tandem lipoprotein
gi|161508368 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   tandem lipoprotein
gi|257860083 Staphylococcus aureus A5948 NCBI   staphylococcal tandem lipoprotein
gi|258452246 Staphylococcus aureus A5948 NCBI   staphylococcal tandem lipoprotein
gi|87126543 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   staphylococcal tandem lipoprotein
gi|87160569 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   staphylococcal tandem lipoprotein
gi|87201432 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193874 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00054
img|637886760 Staphylococcus aureus aureus USA300 IMG   staphylococcal tandem lipoprotein
img|637892733 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794404 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308076 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible staphylococcal tandem lipoprotein
kegg|saa:SAUSA300_0102 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   staphylococcal tandem lipoprotein
kegg|sae:NWMN_0044 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00054 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0111 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   tandem lipoprotein
ref|YP_001331079.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0044
ref|YP_001574027.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   tandem lipoprotein
ref|YP_492819.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   staphylococcal tandem lipoprotein
ref|YP_498659.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00054
ref|ZP_05700260.1 Staphylococcus aureus A5948 RefSeq   staphylococcal tandem lipoprotein
tr|A6QD84 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YZ25 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible staphylococcal tandem lipoprotein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search