The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.466: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Sodium-dependent transporter
Translate Function Assignments



Context on contig NC_009641 from base 468675 to 480942 (12268 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
460 468675 471380 2706 +           Hypothetical transmembrane protein coupled to NADH-ubiquinone oxidoreductase chain 5 homolog locus|NWMN_0419, protein_id|YP_001331453.1, gi|151220631, geneID|5332200
461 471542 471904 363 + 161         Uncharacterized protein YbcI locus|NWMN_0420, protein_id|YP_001331454.1, gi|151220632, geneID|5330224
462 472549 472133 417 - 228         FIG01108044: hypothetical protein  
463 472587 473261 675 + 37         PAP2 family phosphatase/haloperoxidase locus|NWMN_0421, protein_id|YP_001331455.1, gi|151220633, geneID|5330225
464 473298 474032 735 + 36         Esterase/lipase family protein locus|NWMN_0422, protein_id|YP_001331456.1, gi|151220634, geneID|5330226
465 474210 474323 114 + 177         FIG01107994: hypothetical protein  
466 474485 475825 1341 + 161         Sodium-dependent transporter locus|NWMN_0423, protein_id|YP_001331457.1, gi|151220635, geneID|5330227
467 476042 476956 915 + 216     6: 3 2 1 4 9 5   Cystathionine beta-synthase (EC 4.2.1.22) gene_name|cysM, locus|NWMN_0424, protein_id|YP_001331458.1, gi|151220636, geneID|5330228
468 476940 478082 1143 + -17     6: 3 2 1 4 7 5   Cystathionine gamma-lyase (EC 4.4.1.1) gene_name|metB, locus|NWMN_0425, protein_id|YP_001331459.1, gi|151220637, geneID|5331851
469 478435 479400 966 + 352     3: 3 2 1   Methionine ABC transporter ATP-binding protein locus|NWMN_0426, protein_id|YP_001331460.1, gi|151220638, geneID|5332125
470 479404 480063 660 + 3     3: 2 1 8   Methionine ABC transporter, permease protein MetI locus|NWMN_0427, protein_id|YP_001331461.1, gi|151220639, geneID|5330229
471 480100 480942 843 + 36     4: 6 3 2 1   Methionine ABC transporter substrate-binding protein locus|NWMN_0428, protein_id|YP_001331462.1, gi|151220640, geneID|5330230

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.466 Sodium-dependent transporter
MMKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
LFVFLIVIVIKSLTLDGALEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVVGQLLDKKLLQQYFGKDRFRL
FSGWYYLIKYAMPVVIILVFIVQLFS

MD5 = 0a1cf0a91cf8b780366c4a92d0991355


  DNA Sequence

>fig|426430.8.peg.466 Sodium-dependent transporter
atgatgaaaagacaacaatcacaatggaagtcatcaactggatttattttagctagtgcg
ggttctgcaatcggtcttggtgccatgtggaaattcccatatatggcagggatttatggc
ggcggtgcctttctagctatgttcttaatattcaccatttttgttgggttgccattactc
attatggaattcactgttgggaaaatgggacggacatatacaacacaaatatatagtaaa
ttaactggtaaaaaatggctcaatatcattggctggaacggtaatttggcagtgtttatt
ttatttggcttctatagtgttatcggtggttggattgtcatttacatcggacaagtatta
tggcaattagttatatttcaacgcatcaatcatctccaagaaatgaattttgaagcggta
atatcaaatccttggttaaccgttctagggcaaggtatattcatattcgctacgatgatt
attgtcatgttaggtgttgaaaaaggattagaaaaggcatcgaaagttatgatgccattg
ctgtttgtctttttaatcgtcattgtgattaagtctttaacattagatggcgccttagaa
ggtgtgaaatttattttacaaccaagagtatcagagattactgctgatggcatcttgttt
gcgctaggtcaatcattctttacgttatcattaggaactacaggtatgattacttatgcg
agttatgcctctaaagacatgacgattaagtcatcagctatttctatcgttgttatgaat
atctttgtatctgtattggcaggtctagctatatttccggctttacatagttttggctat
gaaccacaagaagggcctggattattatttaaagtactgccaatggtctttagtcaaatg
catctaggcacattattctatttgggattcttagtgctgttcttatttgcggctttaacg
tcatctatttctttattagaattaaatgtttctaacttcacgaagaatgacaatacaaaa
cgtaaaaaagtcgcagtgatcggtagtattttagtatttatcattagtattccagcaacc
ttatcttttggtatcttaaaagatgtaagattcggtgcgggaacgatttttgataatatg
gatttcatcgtttcgaatgtattgatgccattaggcgcattaggtactacgcttgtcgta
ggacaattattagataaaaaattattacaacaatattttggtaaagatcgatttagatta
ttcagtggttggtattacttaattaagtatgcgatgcctgtcgttattattttagtcttt
atcgtgcaattatttagttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.466 Sodium-dependent transporter
gatattttagaagaaaatgttattcgctttttcaatgctttaacataattgaagatttta
aaaattaacacttgagtgacgatgttattatatttgtcatttgagtgttttttgtggcgt
gatagtatagggaacttagctaaagttaatttgtagtgtgatgtcgtggaaatattatgg
agttataccagaagttgatttgtattgtaatgtcgtggaaattttatgggcattgcacct
gaagttgttatgtggcgagatgttggggatatagatggtgttgtatgtggcgagatattg
gcgcacgtatacagcgttgaaccagaaaatttaatgtagcgtaatgacaacacattacaa
gagttgattatattatgataaatccaggtgctaccgtattaatgaaacaattttgatgca
ggtgtattgcatgttatttacatacatgttagagtgttacttaaacacgtagacgcttta
acgctttaaaggagatgtgaatgatgaaaagacaacaatcacaatggaagtcatcaactg
gatttattttagctagtgcgggttctgcaatcggtcttggtgccatgtggaaattcccat
atatggcagggatttatggcggcggtgcctttctagctatgttcttaatattcaccattt
ttgttgggttgccattactcattatggaattcactgttgggaaaatgggacggacatata
caacacaaatatatagtaaattaactggtaaaaaatggctcaatatcattggctggaacg
gtaatttggcagtgtttattttatttggcttctatagtgttatcggtggttggattgtca
tttacatcggacaagtattatggcaattagttatatttcaacgcatcaatcatctccaag
aaatgaattttgaagcggtaatatcaaatccttggttaaccgttctagggcaaggtatat
tcatattcgctacgatgattattgtcatgttaggtgttgaaaaaggattagaaaaggcat
cgaaagttatgatgccattgctgtttgtctttttaatcgtcattgtgattaagtctttaa
cattagatggcgccttagaaggtgtgaaatttattttacaaccaagagtatcagagatta
ctgctgatggcatcttgtttgcgctaggtcaatcattctttacgttatcattaggaacta
caggtatgattacttatgcgagttatgcctctaaagacatgacgattaagtcatcagcta
tttctatcgttgttatgaatatctttgtatctgtattggcaggtctagctatatttccgg
ctttacatagttttggctatgaaccacaagaagggcctggattattatttaaagtactgc
caatggtctttagtcaaatgcatctaggcacattattctatttgggattcttagtgctgt
tcttatttgcggctttaacgtcatctatttctttattagaattaaatgtttctaacttca
cgaagaatgacaatacaaaacgtaaaaaagtcgcagtgatcggtagtattttagtattta
tcattagtattccagcaaccttatcttttggtatcttaaaagatgtaagattcggtgcgg
gaacgatttttgataatatggatttcatcgtttcgaatgtattgatgccattaggcgcat
taggtactacgcttgtcgtaggacaattattagataaaaaattattacaacaatattttg
gtaaagatcgatttagattattcagtggttggtattacttaattaagtatgcgatgcctg
tcgttattattttagtctttatcgtgcaattatttagttaatatatagaagcatctgaca
cacaagtatttgtgttgctcaggtgtttttttgtttggaattgaaaatttagtactggtt
ctgaattaatcgaaacttagataattgcaaaataacaaaatgtcgtttataattcttatc
tgaaaagtaagaattaaaattgagacatgaagaaaggtttcattcatttgatcggcatgt
cagatgagggtgcatctatgattacttatgatttaattggcaatacaccattagtactgt
tagaacattatagtgatgataaagttaaaatttatgccaagcttgaacaatggaatcctg
gaggcagtgttaaagacagactcgggaaatatttagtagagaaggcaattcaagaagggc
gtgtgcgtgcaggtcaaactattgttgaagcgactgctggtaatacaggcatagggttag
ctattgcagcgaatagacatcatttgaaatgtaagatctttgcgccgtatggtttttcag
a


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005328       F:neurotransmitter:sodium symporter activity
GO:0005887       C:integral to plasma membrane
GO:0006836       P:neurotransmitter transport
dbj|BAF66695.1 Staphylococcus aureus subsp. aureus str. Newman     sodium-dependent symporter protein
fig|426430.6.peg.423 Staphylococcus aureus subsp. aureus str. Newman FIG   Sodium-dependent transporter
fig|451515.3.peg.504 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Sodium-dependent transporter
fig|451516.9.peg.494 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Sodium-dependent transporter
fig|452948.4.peg.1072 Staphylococcus aureus 930918-3 FIG   Sodium-dependent transporter
fig|455227.3.peg.1772 Staphylococcus aureus D30 FIG   Sodium-dependent transporter
fig|546342.3.peg.1790 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Sodium-dependent transporter
fig|546343.3.peg.311 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Sodium-dependent transporter
fig|553567.3.peg.1974 Staphylococcus aureus A5948 FIG   Sodium-dependent transporter
fig|553590.4.peg.2529 Staphylococcus aureus A9754 FIG   Sodium-dependent transporter
fig|553594.3.peg.1905 Staphylococcus aureus A9765 FIG   Sodium-dependent transporter
fig|644279.4.peg.530 Staphylococcus aureus subsp. aureus 132 FIG   Sodium-dependent transporter
fig|93062.19.peg.488 Staphylococcus aureus subsp. aureus COL FIG   Sodium-dependent transporter
gb|EEV82705.1 Staphylococcus aureus A5948     sodium-dependent symporter protein
gb|EEW45141.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0983
gb|EEW46754.1 Staphylococcus aureus D30     hypothetical protein SAD30_1325
gi|150373435 Staphylococcus aureus subsp. aureus str. Newman NCBI   sodium-dependent symporter protein
gi|151220635 Staphylococcus aureus subsp. aureus str. Newman NCBI   sodium-dependent symporter protein
gi|257859865 Staphylococcus aureus A5948 NCBI   sodium-dependent symporter protein
gi|258452465 Staphylococcus aureus A5948 NCBI   sodium-dependent symporter protein
gi|259160109 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0983
gi|259162178 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1325
img|640794783 Staphylococcus aureus aureus Newman IMG   sodium-dependent symporter protein
kegg|sae:NWMN_0423 Staphylococcus aureus subsp. aureus Newman KEGG   sodium-dependent symporter protein
ref|YP_001331457.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   sodium-dependent symporter protein
ref|ZP_05700473.1 Staphylococcus aureus A5948 RefSeq   sodium-dependent symporter protein
tr|A6QEB3 Staphylococcus aureus (strain Newman) TrEMBL   Transporter


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search