The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.361: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108359: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 372260 to 384332 (12073 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
355 373606 372260 1347 -           Putative integral membrane protein gene_name|ulaA, locus|NWMN_0322, protein_id|YP_001331356.1, gi|151220534, geneID|5330161
356 373860 373621 240 - 14         FIG01108524: hypothetical protein locus|NWMN_0323, protein_id|YP_001331357.1, gi|151220535, geneID|5330162
357 374350 373907 444 - 46         PTS system, IIA component locus|NWMN_0324, protein_id|YP_001331358.1, gi|151220536, geneID|5330163
358 376310 374355 1956 - 4         Putative transcriptional antiterminator, BglG family / PTS system, mannitol/fructose-specific IIA component (EC 2.7.1.69) locus|NWMN_0325, protein_id|YP_001331359.1, gi|151220537, geneID|5330164
359 376522 376941 420 + 211     1: 3   Transcriptional regulator, MarR family locus|NWMN_0326, protein_id|YP_001331360.1, gi|151220538, geneID|5330165
360 377048 378403 1356 + 106     1: 2   Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps locus|NWMN_0327, protein_id|YP_001331361.1, gi|151220539, geneID|5330166
361 378507 378947 441 + 103         FIG01108359: hypothetical protein locus|NWMN_0328, protein_id|YP_001331362.1, gi|151220540, geneID|5330167
362 380388 379030 1359 - 82         Glycerol-3-phosphate transporter locus|NWMN_0329, protein_id|YP_001331363.1, gi|151220541, geneID|5330168
363 380696 381622 927 + 307     1: 1   Glyoxalase family protein locus|NWMN_0330, protein_id|YP_001331364.1, gi|151220542, geneID|5330169
364 381636 382697 1062 + 13         Bacterial luciferase family protein locus|NWMN_0331, protein_id|YP_001331365.1, gi|151220543, geneID|5330170
365 382711 383277 567 + 13     1: 4   FMN reductase (EC 1.5.1.29) locus|NWMN_0332, protein_id|YP_001331366.1, gi|151220544, geneID|5330171
366 384332 383337 996 - 59         Putative membrane protein YeiH locus|NWMN_0333, protein_id|YP_001331367.1, gi|151220545, geneID|5330172

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.361 FIG01108359: hypothetical protein
MCKSKILLKNIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKSGYFVTC
WTKDEDNYNRPYKIEEFADYLIVAVIDDELNGYFLFPRELLVEKGILASSKYQGKMAFRV
YPKWCNQLNKTAGQTQKWQCKYFFEY

MD5 = f0ffe2072fb88fbcdeab6186f0202ce3


  DNA Sequence

>fig|426430.8.peg.361 FIG01108359: hypothetical protein
atgtgtaaatctaaaatactgttgaaaaatatttttagtgaagaatcagaagttaaagat
ttaactgaagaaaaatataatcaagattacgaagcattaacatttagctttaaagaggaa
acatatcaaagtaggttagctaagaaaacaccgactaaatcgggatatttcgtgacatgt
tggacaaaagacgaagataattataatcggccatacaaaattgaagagtttgctgattac
ctgattgttgctgttatcgatgatgaattaaatggctactttctatttcctagggaatta
ttggtagaaaaaggtatcttagcttcatctaagtatcaagggaaaatggcttttagagtt
tatcctaagtggtgtaatcaattgaataaaacagcagggcaaacacaaaagtggcaatgt
aaatatttttttgaatactaa


  DNA with Flanking Sequence

>fig|426430.8.peg.361 FIG01108359: hypothetical protein
catgtctatcggcgttatctttgttgtatgtatgagtgctgtatttacaattggacatca
tatggtcggactatttactactgatcaagccattgttgagatggcgacatttattttgaa
agtaacaatggcatcattattattaaatggtataggtttcttgtttactggtatgcttca
agcgactgggcaaggtcgtggtgctacaattatggccattttacaaggtgcaattatcat
tccagtattatttattatgaatgctttgtttggactaacaggtgtcatttggtcattatt
aattgctgagtcactttgtgctttagcagcaatgttaatcgtctatttattacgtgatcg
tttgacagttgatacatctgaattaatagaaggttaaatatttcgtccacttctggctga
gtatatttcggtcggaagtgtatttttcgaaaaaaataaatatatgatacgattatgaaa
aaataaagtgagattggcatatgtgtaaatctaaaatactgttgaaaaatatttttagtg
aagaatcagaagttaaagatttaactgaagaaaaatataatcaagattacgaagcattaa
catttagctttaaagaggaaacatatcaaagtaggttagctaagaaaacaccgactaaat
cgggatatttcgtgacatgttggacaaaagacgaagataattataatcggccatacaaaa
ttgaagagtttgctgattacctgattgttgctgttatcgatgatgaattaaatggctact
ttctatttcctagggaattattggtagaaaaaggtatcttagcttcatctaagtatcaag
ggaaaatggcttttagagtttatcctaagtggtgtaatcaattgaataaaacagcagggc
aaacacaaaagtggcaatgtaaatatttttttgaatactaataaaaagtcatatggttga
acttataagagatgaatatatcatctttcgataagataaccatatgactttattttttat
catttaatgatgaacggtttcttgtcctactttattccaagtgaggataaagctcaacat
tgcaaacacactaattgctgttaataaaataaaaccgacatcccatccgaatttatcaac
tacagcacctaagacgatgttggccattacagcaccaaacagataaccaaataatcctgt
taatccagctgctgtgccagctgcttttttaggtacataatctaatgcttgtaaaccaat
taacataactggtccatatattaagaaaccaatggcaattaatgagacattgtctaacca
agcattgcctggaggatttaaccaataaattaatacaaatactgtgacacctaacataaa
gaagaaacctgcaggtccacgacgacctttgaataatttatcagaaatgtaaccacataa
t


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0281 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0406 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_0336 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF66600.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.67 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108359: hypothetical protein
fig|426430.6.peg.330 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108359: hypothetical protein
fig|451515.3.peg.399 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108359: hypothetical protein
fig|451516.9.peg.389 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108359: hypothetical protein
fig|452948.4.peg.2324 Staphylococcus aureus 930918-3 FIG   FIG01108359: hypothetical protein
fig|546342.3.peg.671 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108359: hypothetical protein
fig|546343.3.peg.682 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108359: hypothetical protein
fig|553567.3.peg.2578 Staphylococcus aureus A5948 FIG   FIG01108359: hypothetical protein
fig|553590.4.peg.2041 Staphylococcus aureus A9754 FIG   FIG01108359: hypothetical protein
fig|553594.3.peg.1309 Staphylococcus aureus A9765 FIG   FIG01108359: hypothetical protein
fig|644279.4.peg.403 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108359: hypothetical protein
fig|93061.3.peg.319 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108359: hypothetical protein
fig|93061.5.peg.288 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108359: hypothetical protein
fig|93062.19.peg.391 Staphylococcus aureus subsp. aureus COL FIG   FIG01108359: hypothetical protein
fig|93062.4.peg.865 Staphylococcus aureus subsp. aureus COL FIG   FIG01108359: hypothetical protein
gb|AAU95769.1 Staphylococcus aureus     MepB
gb|AAW38875.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0406
gb|ABD20700.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29485.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28386.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0356
gb|EEV82137.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373340 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220540 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0328
gi|160367415 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0356
gi|161508606 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0356
gi|221137691 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_03413
gi|221140669 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_03401
gi|257859282 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258453072 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|53854859 Staphylococcus aureus NCBI   MepB
gi|57286781 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0406
gi|57652595 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0406
gi|87126186 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160212 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0336
gi|87201675 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194117 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00316
img|637151181 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886991 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892980 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794688 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308314 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641773016 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0336 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0406 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0328 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00316 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0356 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331362.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0328
ref|YP_001574265.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0356
ref|YP_185298.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0406
ref|YP_493050.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0336
ref|YP_498906.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00316
ref|ZP_03562495.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_03413
ref|ZP_03565162.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_03401
ref|ZP_05701065.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QE18 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8YZG0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FJS8 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G139 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HIV9 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q5Y810 Staphylococcus aureus TrEMBL   MepB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search