The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2762: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Accessory secretory protein Asp3
Translate Function Assignments



Context on contig NC_009641 from base 2806865 to 2824337 (17473 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2759 2808223 2806865 1359 -       1: 1   GftB: Glycosyl transferase, family 8 locus|NWMN_2546, protein_id|YP_001333580.1, gi|151222758, geneID|5331586
2760 2809724 2808216 1509 - -8     1: 1   Poly(glycerol-phosphate) alpha-glucosyltransferase GftA (EC 2.4.1.52) locus|NWMN_2547, protein_id|YP_001333581.1, gi|151222759, geneID|5331587
2761 2812132 2809742 2391 - 17     2: 1 3   Protein export cytoplasm protein SecA2 ATPase RNA helicase (TC 3.A.5.1.1) locus|NWMN_2548, protein_id|YP_001333582.1, gi|151222760, geneID|5331588
2762 2813081 2812122 960 - -11     1: 1   Accessory secretory protein Asp3 locus|NWMN_2549, protein_id|YP_001333583.1, gi|151222761, geneID|5331589
2763 2814627 2813059 1569 - -23     1: 1   Accessory secretory protein Asp2 locus|NWMN_2550, protein_id|YP_001333584.1, gi|151222762, geneID|5331590
2764 2816170 2814617 1554 - -11     1: 1   Accessory secretory protein Asp1 locus|NWMN_2551, protein_id|YP_001333585.1, gi|151222763, geneID|5331591
2765 2817392 2816181 1212 - 10     1: 1   Preprotein translocase SecY2 subunit (TC 3.A.5.1.1) gene_name|secY, locus|NWMN_2552, protein_id|YP_001333586.1, gi|151222764, geneID|5331592
2766 2824337 2817522 6816 - 129     1: 2   Predicted cell-wall-anchored protein SasA (LPXTG motif) locus|NWMN_2553, protein_id|YP_001333587.1, gi|151222765, geneID|5331593

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
SecY2-SecA2_Specialized_Transport_System RossO Accessory secretory protein Asp3


  Protein Sequence

>fig|426430.8.peg.2762 Accessory secretory protein Asp3
MLKNKTFKVTWNYISQTTFMYGSKVSFSNGEVTFINPLMPSGLPIHEWLMLKQFSKYKSA
PSLPILRRGQHYKLHFDFDATPAGSVYFIIIFYNKNGTKLSTEIVKSNSITIQYPDEAYA
YKIKMMNAASTSLIFRCLTITEMTHQYDLEYKSMRVTKIGDDQYGNDMINVIIAEPSDTY
PTISNDFLKLFGHVWLVERWMDDNIEGNIKQLKNDLQSQDTLKAINLISYGSKSNVFVTY
VAQHLGCKVYRTSHEDDDLKGWLTEHVPGNHELKDTNVEVYFKEEQDKHLNYMSRLMNPV
RFLDYLDVSKLNGGEVNET

MD5 = 4522941cbd70ce69b354fd17508f790c


  DNA Sequence

>fig|426430.8.peg.2762 Accessory secretory protein Asp3
atgctgaaaaacaaaacatttaaagttacttggaattatatttcacaaactacatttatg
tatggctctaaagtatcattttcaaatggtgaagtgacttttataaatcctttgatgccc
tctggattaccgattcatgagtggttgatgttaaagcaattttcaaaatataaaagtgcg
ccaagtttaccaattttgcgtagaggacagcattataaattgcattttgattttgatgca
acgcctgctggttcagtgtattttatcatcattttttataataaaaatggcacaaaacta
agtactgagattgtaaagtcaaatagtattacgattcaatatcctgatgaagcctatgct
tataaaataaaaatgatgaatgcagcatcgacgagtcttatatttagatgtttaacaatc
acagagatgacgcatcaatatgatttagagtataaaagcatgcgggtgacgaagataggc
gatgaccaatatggaaatgatatgatcaatgtcattattgcagaaccatctgacacctat
ccaactatttcgaatgattttttgaaactgtttggtcatgtttggctcgttgaacgttgg
atggacgacaatatcgagggaaatattaagcaactaaagaatgatttgcaaagtcaagat
accctaaaggctattaatttgattagttatgggtcaaagtcaaatgtttttgtaacttat
gtcgctcagcatttgggttgcaaagtgtatcgtacaagccatgaagatgatgatttaaaa
ggatggcttacagaacatgtcccaggaaatcatgaactaaaagatacaaatgtcgaggtt
tattttaaagaagagcaagacaaacatctaaattatatgtcacgtttaatgaatccagta
cgatttttagattacttagatgtatcgaaactgaatggtggggaagtaaatgaaacataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2762 Accessory secretory protein Asp3
cgagacattagaaaagctgaattttaaatcacatgaattaatattatctggtttatctat
gggttcatttggtgccttgtattatggtgctcagttaaatcctcaggcaattattgttgg
taaaccacttgttaatattggaacgattgctgaacatatgcgattacttagaccagaaga
gttcggtacagcattagacgtcctggtgtctaatgaaggtgatacatctcaagcgtcgat
acaggcattaaatcaaaaattttggcaaacatttcaaaagaaatcattgtcacaaactgt
ttttgccatagcatatatgcaacatgatgattatgatccacatgcatttcaagagctatt
acctgtattgacagcacaccaagcaagagtgatgaatcgcagtattcctgggcgacataa
tgatgattcacctaccattgcaagttggtttgttaatttttacaacattattttggaaga
caagtttgggagagttcaacatgctgaaaaacaaaacatttaaagttacttggaattata
tttcacaaactacatttatgtatggctctaaagtatcattttcaaatggtgaagtgactt
ttataaatcctttgatgccctctggattaccgattcatgagtggttgatgttaaagcaat
tttcaaaatataaaagtgcgccaagtttaccaattttgcgtagaggacagcattataaat
tgcattttgattttgatgcaacgcctgctggttcagtgtattttatcatcattttttata
ataaaaatggcacaaaactaagtactgagattgtaaagtcaaatagtattacgattcaat
atcctgatgaagcctatgcttataaaataaaaatgatgaatgcagcatcgacgagtctta
tatttagatgtttaacaatcacagagatgacgcatcaatatgatttagagtataaaagca
tgcgggtgacgaagataggcgatgaccaatatggaaatgatatgatcaatgtcattattg
cagaaccatctgacacctatccaactatttcgaatgattttttgaaactgtttggtcatg
tttggctcgttgaacgttggatggacgacaatatcgagggaaatattaagcaactaaaga
atgatttgcaaagtcaagataccctaaaggctattaatttgattagttatgggtcaaagt
caaatgtttttgtaacttatgtcgctcagcatttgggttgcaaagtgtatcgtacaagcc
atgaagatgatgatttaaaaggatggcttacagaacatgtcccaggaaatcatgaactaa
aagatacaaatgtcgaggtttattttaaagaagagcaagacaaacatctaaattatatgt
cacgtttaatgaatccagtacgatttttagattacttagatgtatcgaaactgaatggtg
gggaagtaaatgaaacataaactagatgttacgataaacgaattaagactaaagtcgatt
agaaaaatagtgaaacgcatcaatacatggagcgatgaagttaaatcatattctgatgat
gcgttaaaacaaaagacaatagaatttaaagaacgtttagcatcaggagttgatacacta
gatacattgttacctgaagcttatgcagtggcacgtgaagcgagctggagagtattaggt
atgtatcctaaagaagttcagttaatcggagcgattgtattgcatgaaggtaacattgcg
gagatgcaaacaggcgaaggtaaaacattaacggcaacgatgcctttatatttaaatgct
ctttcgggaaaaggaacatatttaattacaacgaatgattatttagcgaagcgagatttt
gaagagatgcaaccattatatgaatggttaggtttaactgcttcattaggttttgttgat
attgtggattatgagtatcaaaaaggggaaaaacgtaata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF68821.1 Staphylococcus aureus subsp. aureus str. Newman     accessory secretory protein Asp3
fig|426430.6.peg.2461 Staphylococcus aureus subsp. aureus str. Newman FIG   Accessory secretory protein Asp3
gi|150375561 Staphylococcus aureus subsp. aureus str. Newman NCBI   accessory secretory protein Asp3
gi|151222761 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2549
img|640796980 Staphylococcus aureus aureus Newman IMG   accessory secretory protein Asp3
kegg|sae:NWMN_2549 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001333583.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2549
tr|A6QKD9 Staphylococcus aureus (strain Newman) TrEMBL   Accessory secretory protein Asp3


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search