The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2759: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: GftB: Glycosyl transferase, family 8
Translate Function Assignments



Context on contig NC_009641 from base 2801862 to 2814627 (12766 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2756 2801862 2803721 1860 +           N-acetylmuramoyl-L-alanine amidase, family 4 locus|NWMN_2543, protein_id|YP_001333577.1, gi|151222755, geneID|5331583
2757 2804548 2803988 561 - 266     2: 3 5   Isochorismatase (EC 3.3.2.1) locus|NWMN_2544, protein_id|YP_001333578.1, gi|151222756, geneID|5331584
2758 2806623 2804716 1908 - 167     1: 2   Predicted cell-wall-anchored protein SasF (LPXAG motif) locus|NWMN_2545, protein_id|YP_001333579.1, gi|151222757, geneID|5331585
2759 2808223 2806865 1359 - 241     1: 1   GftB: Glycosyl transferase, family 8 locus|NWMN_2546, protein_id|YP_001333580.1, gi|151222758, geneID|5331586
2760 2809724 2808216 1509 - -8     1: 1   Poly(glycerol-phosphate) alpha-glucosyltransferase GftA (EC 2.4.1.52) locus|NWMN_2547, protein_id|YP_001333581.1, gi|151222759, geneID|5331587
2761 2812132 2809742 2391 - 17     2: 1 4   Protein export cytoplasm protein SecA2 ATPase RNA helicase (TC 3.A.5.1.1) locus|NWMN_2548, protein_id|YP_001333582.1, gi|151222760, geneID|5331588
2762 2813081 2812122 960 - -11     1: 1   Accessory secretory protein Asp3 locus|NWMN_2549, protein_id|YP_001333583.1, gi|151222761, geneID|5331589
2763 2814627 2813059 1569 - -23     1: 1   Accessory secretory protein Asp2 locus|NWMN_2550, protein_id|YP_001333584.1, gi|151222762, geneID|5331590

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
SecY2-SecA2_Specialized_Transport_System RossO GftB: Glycosyl transferase, family 8


  Protein Sequence

>fig|426430.8.peg.2759 GftB: Glycosyl transferase, family 8
MIKLFDYFNDHSRKLYESFKASKLEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKP
RFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVD
YYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAF
ALFFIKQLEITEHHFVINSLALPFSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDM
KRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNI
KVLVETLPDFKFHIAAITEMSDKLMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEG
NEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQ
QQFRDALLAQKAHAHEISREQFEQVFKQALES

MD5 = f5f1b492302de7eff3a61f7e8377c2a8


  DNA Sequence

>fig|426430.8.peg.2759 GftB: Glycosyl transferase, family 8
atgattaaattatttgattactttaacgatcattcacgaaagttatatgagtcttttaaa
gccagtaagttggaagaagatttaacaattgtactcaatgacaatggctttttaccggac
gatgttatatcaccgtatcaattttttgcagataatcataatacagaaaatatgaaacca
cgattttttaatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcg
gctacaattaatgatatgggacgtctacgaggtaaaatattttatcaaagtggagagcgc
cctagaattgttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgat
tattattctaagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcg
atcttgaagaaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaaca
tctgatgtcatattggattggcaagggaagtcttactttttcccttcaaagctcgcattc
gcattattttttatcaagcaacttgaaattacggaacatcatttcgttattaactcacta
gccctaccattttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatgg
caagaacactgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatg
aaacgacattgtaatattattattccagataaaaacgaatatgaaacgatgctcaatata
gcagacgcaaaggttcaatctcgtattttacaaggcggatatctatataactatcgtagt
cgtaatagatatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatc
aaggtattggttgaaactttaccagattttaagtttcacatcgctgctattacagagatg
tctgataagctaatgcaacttgatcaatatgctaatgtgcatttatacccatctattaat
attgacagggtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggt
aatgaaattttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttat
cgtcaaaccgcacaccatgctaaagtaacattatcagagcacttatttgagcataatgat
gagataacaatggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaa
caacagtttcgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaa
caattcgagcaagtttttaaacaggcgctcgaaagctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2759 GftB: Glycosyl transferase, family 8
tgattggcttgtcaaagcggttatcgtggctaaacgacaagtgccagaattaacatttga
tatttatggagaaggtagcgagaagacgcgactgcgtaaaattattgatacacaccgcgc
acaagattatattcgtttactagggcatgttaaacttgatgaaatttataatgattatga
gttatttctttctgcatcaactagcgaaggttttgggttaacactaatggaagcggtagg
ctcaggactaggtatgattggattaaatgtgaattatggtaacccaacctttattcgaga
tggggaaaatggctacttggtaccttttgataccgacgaagatagtgtggatgatgttat
cgcaaaactagctcatgccattgtaatgtattttaacaatggtccccagacaccacatga
catctcttatgaagtggcacagcaatttatgactcaagatattattttaaaatgggaaac
attagttcaagaggtgctacatgattaaattatttgattactttaacgatcattcacgaa
agttatatgagtcttttaaagccagtaagttggaagaagatttaacaattgtactcaatg
acaatggctttttaccggacgatgttatatcaccgtatcaattttttgcagataatcata
atacagaaaatatgaaaccacgattttttaatcaggttactgtaccagctttttgggaaa
ttaaaggtaacaacaattcggctacaattaatgatatgggacgtctacgaggtaaaatat
tttatcaaagtggagagcgccctagaattgttagtcgtgtcgaatggtttgatgaccaac
aacgtgtccgatttgtcgattattattctaagaatggtattaaatttgcacaaactgttt
acgatttaaatcgtaaagcgatcttgaagaaatatatgacagcagaaggtaaagaagtga
tttatgaaaattttgtaacatctgatgtcatattggattggcaagggaagtcttactttt
tcccttcaaagctcgcattcgcattattttttatcaagcaacttgaaattacggaacatc
atttcgttattaactcactagccctaccattttcagtgttatataatttgccatcaaaag
gtagtgatgttttggtatggcaagaacactgtaatggtaatgtcccgggaaatatgcaat
tgatgtgtaaaggtgatatgaaacgacattgtaatattattattccagataaaaacgaat
atgaaacgatgctcaatatagcagacgcaaaggttcaatctcgtattttacaaggcggat
atctatataactatcgtagtcgtaatagatatactaaagaaattgtaatattaactaact
cggatcaacttcgtaacatcaaggtattggttgaaactttaccagattttaagtttcaca
tcgctgctattacagagatgtctgataagctaatgcaacttgatcaatatgctaatgtgc
atttatacccatctattaatattgacagggtaaatgaactataccagttatgtgatattt
atcttgatatcaatgagggtaatgaaattttaaatgcggtggaacaagcgtttgactatg
agttgttgattttaggttatcgtcaaaccgcacaccatgctaaagtaacattatcagagc
acttatttgagcataatgatgagataacaatggaaagtaaagaccaattaatacaaatgt
tagaaagtttgaaagatcaacaacagtttcgagatgctttattagcacaaaaagcacatg
cacacgaaatctcgcgtgaacaattcgagcaagtttttaaacaggcgctcgaaagctaaa
aggaaaaagcagtctaaaataaaacatcatttaatataaaagatttgacgtaatatgatg
ttagcgacatggacaatatgatattacgtcatgcttgttttgtttacttaaatataagct
aagtaataagtagataattactaacaacaataactagatagataagtgtaaatttcttgt
aaacaggtatataatagtatgtaattctttgaaggaagtaagtgaggaaggagtatgttg
atggctaaatatcgagggaaaccgtttcaattatatgtaaagttatcgtgttcgacaatg
atggcgacaagtatcattttaacgaatatcttgccgtacgatgcccaagctgcatctgaa
aaggatactgaaattacaaaagagatattatctaagcaagatttattagacaaagttgac
aaggcaattcgtcaaattgagcaattaaaacagttatcggcttcatctaaagaacattat
aaagcacaactaaatgaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2664 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL2669 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2582 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68818.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2007 Staphylococcus aureus subsp. aureus USA300 FIG   GftB: Glycosyl transferase, family 8
fig|426430.6.peg.2458 Staphylococcus aureus subsp. aureus str. Newman FIG   GftB: Glycosyl transferase, family 8
fig|451515.3.peg.2762 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   GftB: Glycosyl transferase, family 8
fig|451516.9.peg.2756 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   GftB: Glycosyl transferase, family 8
fig|455227.3.peg.1526 Staphylococcus aureus D30 FIG   GftB: Glycosyl transferase, family 8
fig|553567.3.peg.925 Staphylococcus aureus A5948 FIG   GftB: Glycosyl transferase, family 8
fig|553590.4.peg.1818 Staphylococcus aureus A9754 FIG   GftB: Glycosyl transferase, family 8
fig|644279.4.peg.18 Staphylococcus aureus subsp. aureus 132 FIG   GftB: Glycosyl transferase, family 8
fig|93061.3.peg.2824 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GftB: Glycosyl transferase, family 8
fig|93061.5.peg.2690 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GftB: Glycosyl transferase, family 8
fig|93062.19.peg.2595 Staphylococcus aureus subsp. aureus COL FIG   GftB: Glycosyl transferase, family 8
fig|93062.4.peg.2100 Staphylococcus aureus subsp. aureus COL FIG   GftB: Glycosyl transferase, family 8
gb|AAW38667.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21874.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31970.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30633.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2647
gb|EEV83784.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW46983.1 Staphylococcus aureus D30     hypothetical protein SAD30_0535
gi|150375558 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222758 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2546
gi|160369662 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2647
gi|161510853 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2647
gi|257860967 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451437 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259162412 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0535
gi|57286573 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652387 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2669
gi|87127360 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161386 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2582
gi|87204160 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196602 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02983
img|637153410 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637889224 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895581 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796977 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310647 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|saa:SAUSA300_2582 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2669 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2546 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02983 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2647 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333580.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2546
ref|YP_001576512.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2647
ref|YP_187457.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2669
ref|YP_495216.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2582
ref|YP_501432.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02983
ref|ZP_05699468.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QKD6 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z5E6 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FDL2 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FUW8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HCQ0 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search