The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2702: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
Translate Function Assignments



Context on contig NC_009641 from base 2731594 to 2742762 (11169 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2695 2731890 2731594 297 -       1: 9   Putative EsaC protein analog (Listeria type 3) locus|NWMN_2484, protein_id|YP_001333518.1, gi|151222696, geneID|5331542
2696 2732246 2731878 369 - -13         FIG01108396: hypothetical protein locus|NWMN_2485, protein_id|YP_001333519.1, gi|151222697, geneID|5331543
2697 2732536 2732261 276 - 14         FIG01108708: hypothetical protein locus|NWMN_2486, protein_id|YP_001333520.1, gi|151222698, geneID|5331544
2698 2733747 2732881 867 - 344         Fructosamine kinase family protein, At3g61080 homolog locus|NWMN_2487, protein_id|YP_001333521.1, gi|151222699, geneID|5331545
2699 2733965 2735029 1065 + 217     3: 21 25 16   Dihydroorotate dehydrogenase (EC 1.3.3.1) gene_name|pyrD, locus|NWMN_2488, protein_id|YP_001333522.1, gi|151222700, geneID|5331546
2700 2735184 2735459 276 + 154         FIG01108350: hypothetical protein locus|NWMN_2489, protein_id|YP_001333523.1, gi|151222701, geneID|5332321
2701 2736367 2735645 723 - 185     7: 26 19 23 14 20 22 15 dlit(28128549) Epoxyqueuosine reductase (EC 1.17.99.6) QueH locus|NWMN_2490, protein_id|YP_001333524.1, gi|151222702, geneID|5331547
2702 2736721 2737170 450 + 353         PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein locus|NWMN_2491, protein_id|YP_001333525.1, gi|151222703, geneID|5331548
2703 2737838 2737251 588 - 80     1: 13   Transcriptional regulator, TetR family locus|NWMN_2492, protein_id|YP_001333526.1, gi|151222704, geneID|5331549
2704 2737971 2739653 1683 + 132         Predicted acyl esterase/dipeptidyl-peptidase locus|NWMN_2493, protein_id|YP_001333527.1, gi|151222705, geneID|5331550
2705 2740165 2739782 384 - 128     8: 1 6 2 8 5 7 3 4   Aspartate 1-decarboxylase (EC 4.1.1.11) gene_name|panD, locus|NWMN_2494, protein_id|YP_001333528.1, gi|151222706, geneID|5331551
2706 2741018 2740167 852 - 1     8: 1 6 2 8 5 7 3 4   Pantoate--beta-alanine ligase (EC 6.3.2.1) gene_name|panC, locus|NWMN_2495, protein_id|YP_001333529.1, gi|151222707, geneID|5332238
2707 2741829 2741011 819 - -8     11: 1 6 24 10 2 12 8 5 7 3 4   3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) gene_name|panB, locus|NWMN_2496, protein_id|YP_001333530.1, gi|151222708, geneID|5332237
2708 2741902 2742762 861 + 72     10: 1 6 2 17 5 7 3 11 4 18   2-dehydropantoate 2-reductase (EC 1.1.1.169) gene_name|panE, locus|NWMN_2497, protein_id|YP_001333531.1, gi|151222709, geneID|5332236

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2702 PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ

MD5 = dafddb1d2b784dae5ad0f1304907fb1a


  DNA Sequence

>fig|426430.8.peg.2702 PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
atgacagcattattcccttatatcgcttttgaaaattcaaaagaagcccttgcatattac
gaagaagtatttggtgcaactgacgttaaacgtttagaagttggcgaagaacaagcgtca
cattttggtatgactaaggaagaagcgcaagaagcaactatgcatgctgaatttgaagtg
cttggcgtaaaagtgttatgttctgattcttttggtcgcgctgacaaaattaataatggc
atatcattattaattgattatgatgttaacaataaggaagatgctgataaagttgaagca
ttctatgagcaaattaaagatcattcttcaattgaaatagaattaccgtttgctgaccaa
ttctggggtggcaaaatgggcgtctttaccgataaatacggtgttcgttggatgttacat
ggtcaagactatactgcaatccaacaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2702 PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
tgtactacaaggtgcacaacaactatgcaataagattttaggtctgattgcttctctttc
ccactgcccgattaatttcttcaacaccttgtcataattaattttttgatttttcatttt
actgataataggttcagcattaatcatgatttaacctcccacatttaatcattaacttct
attatatatgattcatattaaatgtcagtcaaaaaagttagaaattcattttaatgcatt
tatatttcgaaaatcccttatgtatctaaaagcattttttaaacttgaattttaaaacac
taaacaacacatacgtctctgtgtcattttcattttttgtatgtcatatatatgtttact
tcatttaaatcaatttcatcttataatttatcgtgtattttacaaaagattgacttcaat
tcatcgtaaaagttatacttttgccattttttaatgtaacatggtgttagtaataaaaat
aatacattgaggtgttttacatgacagcattattcccttatatcgcttttgaaaattcaa
aagaagcccttgcatattacgaagaagtatttggtgcaactgacgttaaacgtttagaag
ttggcgaagaacaagcgtcacattttggtatgactaaggaagaagcgcaagaagcaacta
tgcatgctgaatttgaagtgcttggcgtaaaagtgttatgttctgattcttttggtcgcg
ctgacaaaattaataatggcatatcattattaattgattatgatgttaacaataaggaag
atgctgataaagttgaagcattctatgagcaaattaaagatcattcttcaattgaaatag
aattaccgtttgctgaccaattctggggtggcaaaatgggcgtctttaccgataaatacg
gtgttcgttggatgttacatggtcaagactatactgcaatccaacaataatgttattgat
aaagatatcatttaataagcttatgttatttagcaaggcaagccactctcgattcatggc
ttgccttattttattgtatatttttaattatcgttgctggcccttgattgacaatcgtat
taaaatgccttattaagtcaactttgtctatacggtttggatcttctacccaatgtctta
taaaagacaatcccgcacctgaaacataactcatgaaataagaaaatggtataccattaa
tttgatcattttcatttttataacgttgtaaatgacacataattaaatcataaagttttt
cgtggatatttgaatctttacccatacgaaacatcaattgataaaatgcgatgtcttttt
ctatcatttctattaaaacggtcataatttgatgtatgttatccgtggataacttaactg
ctccatttaacttctcatcatgaatgaagtctcttatttcctccaactgctggtcctcta
atttttcaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2610 Staphylococcus aureus NCTC 8325     glyoxalase/bleomycin resistance protein/dioxygenase:3-demethylubiquinone-9 3-methyltransferase
cmr|SACOL2609 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_2529 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68763.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1640 Staphylococcus aureus subsp. aureus USA300 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|426430.6.peg.2405 Staphylococcus aureus subsp. aureus str. Newman FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|450394.6.peg.1595 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|451515.3.peg.2706 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|451516.9.peg.2699 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|452948.4.peg.462 Staphylococcus aureus 930918-3 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|455227.3.peg.1206 Staphylococcus aureus D30 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|548474.3.peg.280 Staphylococcus aureus subsp. aureus TCH130 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|553567.3.peg.1020 Staphylococcus aureus A5948 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|553590.4.peg.1763 Staphylococcus aureus A9754 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|553594.3.peg.1381 Staphylococcus aureus A9765 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|644279.4.peg.2744 Staphylococcus aureus subsp. aureus 132 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|93061.3.peg.2757 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|93061.5.peg.2633 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|93062.19.peg.2538 Staphylococcus aureus subsp. aureus COL FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
fig|93062.4.peg.1920 Staphylococcus aureus subsp. aureus COL FIG   PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
gb|AAW38609.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21836.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31908.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30573.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2587
gb|EES94695.1 Staphylococcus aureus subsp. aureus USA300_TCH959     PhnB family protein
gb|EES96812.1 Staphylococcus aureus subsp. aureus TCH130     PhnB family protein
gb|EEV83648.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45633.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0371
gb|EEW47270.1 Staphylococcus aureus D30     hypothetical protein SAD30_0837
gi|150375503 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222703 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2491
gi|160369602 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2587
gi|161510793 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2587
gi|253725966 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   PhnB family protein
gi|253728083 Staphylococcus aureus subsp. aureus TCH130 NCBI   PhnB family protein
gi|253730273 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   PhnB family protein
gi|253733969 Staphylococcus aureus subsp. aureus TCH130 NCBI   PhnB family protein
gi|257860828 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451534 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160611 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0371
gi|259162704 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0837
gi|57286515 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652329 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2609
gi|87127322 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161348 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2529
gi|87204098 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196540 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02912
img|637153352 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637889171 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895514 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796922 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310587 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771141 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_2529 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2609 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2491 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02912 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2587 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333525.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2491
ref|YP_001576452.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2587
ref|YP_187399.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2609
ref|YP_495163.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2529
ref|YP_501365.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02912
ref|ZP_04864438.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   PhnB family protein
ref|ZP_04868134.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   PhnB family protein
ref|ZP_05699562.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QK81 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z3J3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5N0F8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   PhnB family protein
tr|C5Q1W5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   PhnB family protein
tr|Q2FDR5 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FV27 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HCV8 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search