The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2685: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01107927: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 2717403 to 2728722 (11320 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2678 2717891 2717403 489 -           acetyltransferase (GNAT) family protein locus|NWMN_2468, protein_id|YP_001333502.1, gi|151222680, geneID|5331526
2679 2718868 2718167 702 - 275         Immunodominant staphylococcal antigen A precursor locus|NWMN_2469, protein_id|YP_001333503.1, gi|151222681, geneID|5331527
2680 2720531 2719476 1056 - 607         Membrane protein locus|NWMN_2470, protein_id|YP_001333504.1, gi|151222682, geneID|5331528
2681 2720677 2720880 204 + 145         FIG01108446: hypothetical protein  
2682 2720923 2721510 588 + 42         TetR family regulatory protein locus|NWMN_2471, protein_id|YP_001333505.1, gi|151222683, geneID|5331529
2683 2721888 2722208 321 + 377         hypothetical protein locus|NWMN_2472, protein_id|YP_001333506.1, gi|151222684, geneID|5331530
2684 2722428 2722658 231 + 219         FIG01108187: hypothetical protein locus|NWMN_2473, protein_id|YP_001333507.1, gi|151222685, geneID|5331531
2685 2723185 2722808 378 - 149         FIG01107927: hypothetical protein locus|NWMN_2474, protein_id|YP_001333508.1, gi|151222686, geneID|5331532
2686 2724023 2723202 822 - 16         NmrA-like protein locus|NWMN_2475, protein_id|YP_001333509.1, gi|151222687, geneID|5331533
2687 2724342 2724043 300 - 19         FIG01108185: hypothetical protein locus|NWMN_2476, protein_id|YP_001333510.1, gi|151222688, geneID|5331534
2688 2724473 2725030 558 + 130     1: 1   Transcriptional regulator, TetR family locus|NWMN_2477, protein_id|YP_001333511.1, gi|151222689, geneID|5331535
2689 2725023 2725727 705 + -8         Oxidoreductase, short-chain dehydrogenase/reductase family locus|NWMN_2478, protein_id|YP_001333512.1, gi|151222690, geneID|5331536
2690 2725825 2726835 1011 + 97         FIG01108025: hypothetical protein locus|NWMN_2479, protein_id|YP_001333513.1, gi|151222691, geneID|5331537
2691 2726855 2727685 831 + 19         Predicted hydrolase/acyltransferase locus|NWMN_2480, protein_id|YP_001333514.1, gi|151222692, geneID|5331538
2692 2728722 2727832 891 - 146     2: 2 3   Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family locus|NWMN_2481, protein_id|YP_001333515.1, gi|151222693, geneID|5331539

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2685 FIG01107927: hypothetical protein
MIQSMWFNLHVQDLEKSAQFYKALGFKINRNPQMLDKMVGIQIGQTTVILIENKHFQNVS
QQSLNTEPNEVMISLGVNTNEEVDQLVNKVKEAGGTVVQEPTVSQGFYGAMFKDLDGHHF
NFLVC

MD5 = 5b3dd3e7ef0df589a92a58d5902eb609


  DNA Sequence

>fig|426430.8.peg.2685 FIG01107927: hypothetical protein
atgattcaatcaatgtggtttaatttgcatgtgcaagatttagaaaagagcgcacagttt
tataaagcgttaggatttaaaataaatagaaacccacaaatgttagataaaatggtcggc
attcaaataggtcaaacaaccgtaattttaatagaaaacaagcattttcaaaatgtaagt
cagcaaagccttaatactgaaccaaatgaagtgatgatttctctaggtgtgaacacaaat
gaagaagttgaccagttggtgaataaagtgaaagaagcgggtggcacagtcgttcaagaa
ccaacagtaagccaagggttttatggagcaatgttcaaagatcttgatggacaccatttt
aattttttggtctgctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2685 FIG01107927: hypothetical protein
tcgaaatcgaactggcccacactttgaagtactagcaaaaatagaaaatagattaatgga
atctaatataaatgcaacagttatcaaaccatcattctttatggataattttttacgcat
tgctaaagtcgaagatgaacgtattacattaccagaatttattaatccgaatataaaatt
cacaatgatttcttctattgatatagctaaaattgcatcgtatatttttgcacatccaca
aagctttacgcatcaatcaatagagattggttccgatgaagttacattaagtgaagcagc
aacaatttttagtgaagtgacaggtaaatctactgttatagaaggagaatttgttagtgg
tgttgcagaaaagcaatggttggaagaaaaaggttatgaagtagactttgaattaatggc
tgaaataaatccaacaagattatcattaagtgattggcttaaagtccaaaactataataa
gtaatgaatggggtgcaatcatgattcaatcaatgtggtttaatttgcatgtgcaagatt
tagaaaagagcgcacagttttataaagcgttaggatttaaaataaatagaaacccacaaa
tgttagataaaatggtcggcattcaaataggtcaaacaaccgtaattttaatagaaaaca
agcattttcaaaatgtaagtcagcaaagccttaatactgaaccaaatgaagtgatgattt
ctctaggtgtgaacacaaatgaagaagttgaccagttggtgaataaagtgaaagaagcgg
gtggcacagtcgttcaagaaccaacagtaagccaagggttttatggagcaatgttcaaag
atcttgatggacaccattttaattttttggtctgctaaaatgaaattctcaaaagaataa
ataaaaagcccatacagagatgaagcgtaatgtgcaccatggtgcgacacattagtgtct
tcaatcagtatgggctttgtttatgaggtcagttggcaccttaagtgcaatacctcgtga
gcaaatattaattttgaatataaccgtattgttggcgaagatcataaactttatctggtg
tgacatcctgaccgattggatcaaccacttttattgtggaaaatgttgttaatacttgtc
ctcggatcatgcttaagtagtcttgacgcaatgcatgttgttcttgtttttcagctacag
taagtggttgtactttttctttatttgcaagttcattaattctatctaaaattttcatat
tgtcatatcctccttagaatcaagtgttgatatattttgagattatttttatatggtaat
ttatcaacacattaagtaatgtttttagtttctcggtcttttgaccagcagatttttg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004462       F:lactoylglutathione lyase activity
cmr|NT03SA2696 Staphylococcus aureus MW2     unknown conserved protein in others, putative
cmr|NT05SA2591 Staphylococcus aureus NCTC 8325     glyoxalase/bleomycin resistance protein/dioxygenase
cmr|NT08SA2625 Staphylococcus aureus subsp. aureus MRSA252     putative glyoxalase
cmr|NT09SA2468 Staphylococcus aureus subsp. aureus MSSA476     putative glyoxalase
cmr|NT11SA2449 Staphylococcus aureus RF122     glyoxalase family protein
cmr|SACOL2590 Staphylococcus aureus subsp. aureus COL     glyoxalase family protein
cmr|SAUSA300_2512 Staphylococcus aureus subsp. aureus USA300-FPR3757     glyoxalase family protein
dbj|BAB96360.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF68746.1 Staphylococcus aureus subsp. aureus str. Newman     glyoxalase family protein
emb|CAG41632.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative glyoxalase
emb|CAG44277.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative glyoxalase
emb|CAI82136.1 Staphylococcus aureus RF122 EMBL   conserved hypothetical protein
fig|196620.1.peg.2495 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107927: hypothetical protein
fig|196620.5.peg.2579 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01107927: hypothetical protein
fig|273036.3.peg.2378 Staphylococcus aureus RF122 FIG   FIG01107927: hypothetical protein
fig|273036.6.peg.2577 Staphylococcus aureus RF122 FIG   FIG01107927: hypothetical protein
fig|282458.1.peg.2514 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01107927: hypothetical protein
fig|282458.4.peg.2687 Staphylococcus aureus subsp. aureus MRSA252 FIG   FIG01107927: hypothetical protein
fig|282459.1.peg.2441 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107927: hypothetical protein
fig|282459.5.peg.2564 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01107927: hypothetical protein
fig|367830.3.peg.1623 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107927: hypothetical protein
fig|426430.6.peg.2388 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107927: hypothetical protein
fig|451515.3.peg.2689 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107927: hypothetical protein
fig|451516.9.peg.2682 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107927: hypothetical protein
fig|452948.4.peg.445 Staphylococcus aureus 930918-3 FIG   FIG01107927: hypothetical protein
fig|455227.3.peg.1189 Staphylococcus aureus D30 FIG   FIG01107927: hypothetical protein
fig|546342.3.peg.1410 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107927: hypothetical protein
fig|546343.3.peg.1743 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107927: hypothetical protein
fig|548470.3.peg.768 Staphylococcus aureus subsp. aureus MN8 FIG   FIG01107927: hypothetical protein
fig|548473.3.peg.940 Staphylococcus aureus subsp. aureus TCH60 FIG   FIG01107927: hypothetical protein
fig|548475.3.peg.1593 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01107927: hypothetical protein
fig|553567.3.peg.1003 Staphylococcus aureus A5948 FIG   FIG01107927: hypothetical protein
fig|553583.3.peg.2429 Staphylococcus aureus A9635 FIG   FIG01107927: hypothetical protein
fig|553590.4.peg.1746 Staphylococcus aureus A9754 FIG   FIG01107927: hypothetical protein
fig|553594.3.peg.1364 Staphylococcus aureus A9765 FIG   FIG01107927: hypothetical protein
fig|585143.3.peg.79 Staphylococcus aureus subsp. aureus 55/2053 FIG   FIG01107927: hypothetical protein
fig|585144.3.peg.53 Staphylococcus aureus subsp. aureus 58-424 FIG   FIG01107927: hypothetical protein
fig|585145.3.peg.851 Staphylococcus aureus subsp. aureus 65-1322 FIG   FIG01107927: hypothetical protein
fig|585146.3.peg.484 Staphylococcus aureus subsp. aureus 68-397 FIG   FIG01107927: hypothetical protein
fig|585147.3.peg.2203 Staphylococcus aureus subsp. aureus A017934/97 FIG   FIG01107927: hypothetical protein
fig|585148.3.peg.2363 Staphylococcus aureus subsp. aureus Btn1260 FIG   FIG01107927: hypothetical protein
fig|585150.3.peg.973 Staphylococcus aureus subsp. aureus C160 FIG   FIG01107927: hypothetical protein
fig|585151.3.peg.2567 Staphylococcus aureus subsp. aureus C427 FIG   FIG01107927: hypothetical protein
fig|585153.3.peg.855 Staphylococcus aureus subsp. aureus E1410 FIG   FIG01107927: hypothetical protein
fig|585154.3.peg.2642 Staphylococcus aureus subsp. aureus EMRSA16 FIG   FIG01107927: hypothetical protein
fig|585156.3.peg.2258 Staphylococcus aureus subsp. aureus M1015 FIG   FIG01107927: hypothetical protein
fig|585157.3.peg.2256 Staphylococcus aureus subsp. aureus M809 FIG   FIG01107927: hypothetical protein
fig|585158.3.peg.631 Staphylococcus aureus subsp. aureus M876 FIG   FIG01107927: hypothetical protein
fig|585160.3.peg.2398 Staphylococcus aureus subsp. aureus WBG10049 FIG   FIG01107927: hypothetical protein
fig|644279.4.peg.2727 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107927: hypothetical protein
fig|762962.3.peg.1929 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01107927: hypothetical protein
fig|93061.3.peg.2739 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107927: hypothetical protein
fig|93061.5.peg.2615 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107927: hypothetical protein
fig|93062.4.peg.1902 Staphylococcus aureus subsp. aureus COL FIG   FIG01107927: hypothetical protein
gb|AAW38591.1 Staphylococcus aureus subsp. aureus COL     glyoxalase family protein
gb|ABD20915.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     glyoxalase family protein
gb|ABD31890.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30555.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible lactoylglutatione lyase
gb|EEV05171.1 Staphylococcus aureus subsp. aureus 55/2053     lactoylglutatione lyase
gb|EEV07814.1 Staphylococcus aureus subsp. aureus 65-1322     lactoylglutatione lyase
gb|EEV10435.1 Staphylococcus aureus subsp. aureus 68-397     glyoxalase
gb|EEV13026.1 Staphylococcus aureus subsp. aureus E1410     glyoxalase
gb|EEV15687.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV68767.1 Staphylococcus aureus A9635     glyoxalase
gb|EEV83631.1 Staphylococcus aureus A5948     glyoxalase
gb|EEW45663.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0401
gb|EEW47255.1 Staphylococcus aureus D30     hypothetical protein SAD30_0822
gi|150375486 Staphylococcus aureus subsp. aureus str. Newman NCBI   glyoxalase family protein
gi|151222686 Staphylococcus aureus subsp. aureus str. Newman NCBI   glyoxalase family protein
gi|160369584 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible lactoylglutatione lyase
gi|161510775 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lactoylglutatione lyase
gi|21205667 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21284224 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2495
gi|221138395 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   lactoylglutatione lyase
gi|221141699 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   lactoylglutatione lyase
gi|257273069 Staphylococcus aureus subsp. aureus 55/2053 NCBI   lactoylglutatione lyase
gi|257276363 Staphylococcus aureus subsp. aureus 65-1322 NCBI   lactoylglutatione lyase
gi|257279848 Staphylococcus aureus subsp. aureus 68-397 NCBI   glyoxalase
gi|257282894 Staphylococcus aureus subsp. aureus E1410 NCBI   glyoxalase
gi|257285571 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257424051 Staphylococcus aureus subsp. aureus 55/2053 NCBI   lactoylglutatione lyase
gi|257426732 Staphylococcus aureus subsp. aureus 65-1322 NCBI   lactoylglutatione lyase
gi|257429367 Staphylococcus aureus subsp. aureus 68-397 NCBI   glyoxalase
gi|257432015 Staphylococcus aureus subsp. aureus E1410 NCBI   glyoxalase
gi|257434975 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257844724 Staphylococcus aureus A9635 NCBI   glyoxalase
gi|257860811 Staphylococcus aureus A5948 NCBI   glyoxalase
gi|258424890 Staphylococcus aureus A9635 NCBI   glyoxalase
gi|258451517 Staphylococcus aureus A5948 NCBI   glyoxalase
gi|259160641 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0401
gi|259162689 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0822
gi|49242902 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative glyoxalase
gi|49245797 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative glyoxalase
gi|49484773 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative glyoxalase
gi|49487354 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative glyoxalase
gi|57286497 Staphylococcus aureus subsp. aureus COL NCBI   glyoxalase family protein
gi|57652311 Staphylococcus aureus subsp. aureus COL NCBI   glyoxalase family protein
gi|82657687 Staphylococcus aureus RF122 NCBI   conserved hypothetical protein
gi|82752156 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB2448c
gi|87126401 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glyoxalase family protein
gi|87160427 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glyoxalase family protein
gi|87204080 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196522 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02894
img|637153334 Staphylococcus aureus aureus COL IMG   glyoxalase family protein
img|637156075 Staphylococcus aureus aureus MRSA252 IMG   putative glyoxalase
img|637158732 Staphylococcus aureus aureus MSSA476 IMG   putative glyoxalase
img|637300312 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817421 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637889154 Staphylococcus aureus aureus USA300 IMG   glyoxalase family protein
img|637895496 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796905 Staphylococcus aureus aureus Newman IMG   glyoxalase family protein
img|641310569 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible lactoylglutatione lyase( EC:4.4.1.5 )
img|641771160 Staphylococcus aureus aureus USA300_TCH959 IMG   possible lactoylglutatione lyase
kegg|saa:SAUSA300_2512 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   glyoxalase family protein
kegg|sab:SAB2448c Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL2590 Staphylococcus aureus subsp. aureus COL KEGG   glyoxalase family protein
kegg|sae:NWMN_2474 Staphylococcus aureus subsp. aureus Newman KEGG   glyoxalase family protein
kegg|sam:MW2495 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02894 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR2655   KEGG   putative glyoxalase
kegg|sas:SAS2461   KEGG   putative glyoxalase
kegg|sax:USA300HOU_2569 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   lactoylglutatione lyase (EC:4.4.1.5)
ref|NP_647312.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2495
ref|YP_001333508.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   glyoxalase family protein
ref|YP_001576434.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   lactoylglutatione lyase
ref|YP_041997.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative glyoxalase
ref|YP_044575.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative glyoxalase
ref|YP_187381.1 Staphylococcus aureus subsp. aureus COL RefSeq   glyoxalase family protein
ref|YP_417897.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB2448c
ref|YP_495146.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   glyoxalase family protein
ref|YP_501347.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02894
ref|ZP_03563197.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   lactoylglutatione lyase
ref|ZP_03566192.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   lactoylglutatione lyase
ref|ZP_05600480.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   lactoylglutatione lyase
ref|ZP_05603134.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   lactoylglutatione lyase
ref|ZP_05605754.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   glyoxalase
ref|ZP_05608378.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   glyoxalase
ref|ZP_05611026.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05687761.1 Staphylococcus aureus A9635 RefSeq   glyoxalase
ref|ZP_05699545.1 Staphylococcus aureus A5948 RefSeq   glyoxalase
tr|A6QK64 Staphylococcus aureus (strain Newman) TrEMBL   Glyoxalase family protein
tr|A8Z3H5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible lactoylglutatione lyase
tr|Q2FDT2 Staphylococcus aureus (strain USA300) TrEMBL   Glyoxalase family protein
tr|Q2FV45 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YWD4 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HCX6 Staphylococcus aureus (strain COL) TrEMBL   Glyoxalase family protein
tr|Q6G699 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative glyoxalase
tr|Q6GDM6 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative glyoxalase
tr|Q8NUP8 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2495


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search