The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2637: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Doubtful CDS
Translate Function Assignments



Context on contig NC_009641 from base 2665461 to 2677008 (11548 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2630 2665461 2666453 993 +       3: 6 8 4   D-lactate dehydrogenase (EC 1.1.1.28) locus|NWMN_2422, protein_id|YP_001333456.1, gi|151222634, geneID|5331495
2631 2667502 2666702 801 - 248         Hydrolase (HAD superfamily) locus|NWMN_2423, protein_id|YP_001333457.1, gi|151222635, geneID|5331496
2632 2667823 2668458 636 + 320     2: 7 3   ABC transporter, ATP-binding protein locus|NWMN_2424, protein_id|YP_001333458.1, gi|151222636, geneID|5331497
2633 2668473 2669195 723 + 14         ABC-2 family transporter protein YydJ locus|NWMN_2425, protein_id|YP_001333459.1, gi|151222637, geneID|5331498
2634 2669975 2669355 621 - 159     2: 9 5   LPXTG specific sortase A gene_name|srtA, locus|NWMN_2426, protein_id|YP_001333460.1, gi|151222638, geneID|5331499
2635 2670169 2670660 492 + 193         Phosphinothricin N-acetyltransferase (EC 2.3.1.-) locus|NWMN_2427, protein_id|YP_001333461.1, gi|151222639, geneID|5332505
2636 2670977 2671090 114 + 316         hypothetical protein  
2637 2671268 2671098 171 - 7         Doubtful CDS locus|NWMN_2428, protein_id|YP_001333462.1, gi|151222640, geneID|5331500
2638 2672346 2671447 900 - 178     2: 1 2   L-serine dehydratase, alpha subunit (EC 4.3.1.17) gene_name|sdhA, locus|NWMN_2429, protein_id|YP_001333463.1, gi|151222641, geneID|5331501
2639 2673040 2672360 681 - 13     2: 1 2   L-serine dehydratase, beta subunit (EC 4.3.1.17) gene_name|sdhB, locus|NWMN_2430, protein_id|YP_001333464.1, gi|151222642, geneID|5332458
2640 2674086 2673043 1044 - 2         Transcriptional regulator pfoR locus|NWMN_2431, protein_id|YP_001333465.1, gi|151222643, geneID|5332460
2641 2674622 2674840 219 + 535         FIG01107948: hypothetical protein locus|NWMN_2432, protein_id|YP_001333466.1, gi|151222644, geneID|5331502
2642 2675032 2675958 927 + 191         FIG01108553: hypothetical protein locus|NWMN_2433, protein_id|YP_001333467.1, gi|151222645, geneID|5331503
2643 2677008 2676040 969 - 81         Esterase/lipase (EC 3.1.1.-) locus|NWMN_2434, protein_id|YP_001333468.1, gi|151222646, geneID|5331504

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2637 Doubtful CDS
MLRLSIIFIAFIINTTITYGYTTEGTWVNLLFKSLSLSMIIVFMFYYIRFVIEKKR

MD5 = ef0200f97abceae9162dd4d22a74c7a6


  DNA Sequence

>fig|426430.8.peg.2637 Doubtful CDS
atgctaagactatcaatcatctttatagcattcatcattaacacaacgattacatatgga
tatacgactgagggaacgtgggtcaatctattatttaaatctttatcgctcagcatgatt
atcgttttcatgttctactatattcgttttgttattgagaaaaagcgttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2637 Doubtful CDS
atccgggcacgctatggcattagcgataagtaatttattaggtttagtttgtgatccagt
agccggacttgttgaaattccttgtgttatgagaaatgcaattggttcgggtaacgcttt
aatttcagcagatttagcattagcaggtattgaaagtagaatccctgttgatgaagttat
tgaagcaatggataaggttggtcgtaaccttcctgcatcattacgtgaaactggattggg
tggactagcaggcacaccaactggcgaagcaattaaacgtaaaatctttggcacagctga
agatatggttaaaaataattaatgagataacaataaaatattgataaaaaagaagcatct
gtctggatcattagtaccagatagatgcttcttaattatctctgaagaagttgaaagatt
tatggaaaatgcatactaatcaaaatagtgattgcaaaagcgcccccgtatatctaaaat
aacttaaaaggagtgatgatatgctaagactatcaatcatctttatagcattcatcatta
acacaacgattacatatggatatacgactgagggaacgtgggtcaatctattatttaaat
ctttatcgctcagcatgattatcgttttcatgttctactatattcgttttgttattgaga
aaaagcgttaaatcaaagctatggggatagtatttgaaaagaataaataaaagggacaat
gtaaatcaatgtaatatgctctacaaagttatattggcagtagttgactgaacgaaaatg
cgcttgtaacaagctttttgggccccaacacagaagctgacgaaaagtcagcttacaata
atgtgcgagttggggtgggacgacgataaagaaatactttttctatagaaattagtattt
cttatgcatgagttttactcatgtattcctatttttaagtacacattagctgtggctaat
gtgtaagaaccactacataataaatcattagtggctctttatcatttctgtcccactccc
ctgagaagtttaaaattttatatgttggcttgttatgttaagggaattaacatggttgtc
ttgtttatattatgtgattcaaacattactagtcttgtaaatctaattcgtaaaatgcta
aatctaaccatctattaaatttaaaacctac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA2560 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT03SA2647 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|SACOL2542 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
dbj|BAB96315.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF68700.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG44231.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|158878.1.peg.2772 Staphylococcus aureus subsp. aureus Mu50 FIG   Doubtful CDS
fig|158878.14.peg.2621 Staphylococcus aureus subsp. aureus Mu50 FIG   Doubtful CDS
fig|158879.1.peg.2643 Staphylococcus aureus subsp. aureus N315 FIG   Doubtful CDS
fig|158879.11.peg.2514 Staphylococcus aureus subsp. aureus N315 FIG   Doubtful CDS
fig|196620.1.peg.2450 Staphylococcus aureus subsp. aureus MW2 FIG   Doubtful CDS
fig|196620.5.peg.2532 Staphylococcus aureus subsp. aureus MW2 FIG   Doubtful CDS
fig|273036.6.peg.2527 Staphylococcus aureus RF122 FIG   Doubtful CDS
fig|282458.4.peg.2638 Staphylococcus aureus subsp. aureus MRSA252 FIG   Doubtful CDS
fig|282459.1.peg.2395 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS
fig|282459.5.peg.2517 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS
fig|359786.13.peg.2694 Staphylococcus aureus subsp. aureus JH9 FIG   Doubtful CDS
fig|359786.3.peg.1825 Staphylococcus aureus subsp. aureus JH9 FIG   Doubtful CDS
fig|359787.11.peg.2656 Staphylococcus aureus subsp. aureus JH1 FIG   Doubtful CDS
fig|359787.3.peg.1016 Staphylococcus aureus subsp. aureus JH1 FIG   Doubtful CDS
fig|418127.6.peg.2578 Staphylococcus aureus subsp. aureus Mu3 FIG   Doubtful CDS
fig|450394.6.peg.1530 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Doubtful CDS
fig|451515.3.peg.2641 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Doubtful CDS
fig|451516.9.peg.2634 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Doubtful CDS
fig|452948.4.peg.396 Staphylococcus aureus 930918-3 FIG   Doubtful CDS
fig|455227.3.peg.2204 Staphylococcus aureus D30 FIG   Doubtful CDS
fig|505321.3.peg.1604 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Doubtful CDS
fig|546342.3.peg.961 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Doubtful CDS
fig|546343.3.peg.1445 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Doubtful CDS
fig|548470.3.peg.816 Staphylococcus aureus subsp. aureus MN8 FIG   Doubtful CDS
fig|548473.3.peg.988 Staphylococcus aureus subsp. aureus TCH60 FIG   Doubtful CDS
fig|553565.3.peg.441 Staphylococcus aureus A5937 FIG   Doubtful CDS
fig|553567.3.peg.955 Staphylococcus aureus A5948 FIG   Doubtful CDS
fig|553568.3.peg.1379 Staphylococcus aureus A6224 FIG   Doubtful CDS
fig|553571.3.peg.548 Staphylococcus aureus A6300 FIG   Doubtful CDS
fig|553573.3.peg.920 Staphylococcus aureus A8115 FIG   Doubtful CDS
fig|553574.3.peg.2233 Staphylococcus aureus A8117 FIG   Doubtful CDS
fig|553577.3.peg.358 Staphylococcus aureus A8796 FIG   Doubtful CDS
fig|553580.3.peg.359 Staphylococcus aureus A8819 FIG   Doubtful CDS
fig|553581.3.peg.162 Staphylococcus aureus A9299 FIG   Doubtful CDS
fig|553583.3.peg.2479 Staphylococcus aureus A9635 FIG   Doubtful CDS
fig|553588.3.peg.2453 Staphylococcus aureus A9719 FIG   Doubtful CDS
fig|553590.4.peg.1698 Staphylococcus aureus A9754 FIG   Doubtful CDS
fig|553592.3.peg.468 Staphylococcus aureus A9763 FIG   Doubtful CDS
fig|553594.3.peg.1525 Staphylococcus aureus A9765 FIG   Doubtful CDS
fig|553596.3.peg.1194 Staphylococcus aureus A9781 FIG   Doubtful CDS
fig|553601.3.peg.676 Staphylococcus aureus A10102 FIG   Doubtful CDS
fig|585143.3.peg.30 Staphylococcus aureus subsp. aureus 55/2053 FIG   Doubtful CDS
fig|585144.3.peg.5 Staphylococcus aureus subsp. aureus 58-424 FIG   Doubtful CDS
fig|585145.3.peg.804 Staphylococcus aureus subsp. aureus 65-1322 FIG   Doubtful CDS
fig|585146.3.peg.435 Staphylococcus aureus subsp. aureus 68-397 FIG   Doubtful CDS
fig|585147.3.peg.2158 Staphylococcus aureus subsp. aureus A017934/97 FIG   Doubtful CDS
fig|585148.3.peg.2316 Staphylococcus aureus subsp. aureus Btn1260 FIG   Doubtful CDS
fig|585149.6.peg.6 Staphylococcus aureus subsp. aureus C101 FIG   Doubtful CDS
fig|585150.3.peg.926 Staphylococcus aureus subsp. aureus C160 FIG   Doubtful CDS
fig|585151.3.peg.2519 Staphylococcus aureus subsp. aureus C427 FIG   Doubtful CDS
fig|585152.3.peg.2520 Staphylococcus aureus subsp. aureus D139 FIG   Doubtful CDS
fig|585153.3.peg.807 Staphylococcus aureus subsp. aureus E1410 FIG   Doubtful CDS
fig|585154.3.peg.2594 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Doubtful CDS
fig|585155.3.peg.79 Staphylococcus aureus subsp. aureus H19 FIG   Doubtful CDS
fig|585156.3.peg.2210 Staphylococcus aureus subsp. aureus M1015 FIG   Doubtful CDS
fig|585157.3.peg.2208 Staphylococcus aureus subsp. aureus M809 FIG   Doubtful CDS
fig|585158.3.peg.583 Staphylococcus aureus subsp. aureus M876 FIG   Doubtful CDS
fig|585159.3.peg.5 Staphylococcus aureus subsp. aureus M899 FIG   Doubtful CDS
fig|585160.3.peg.2350 Staphylococcus aureus subsp. aureus WBG10049 FIG   Doubtful CDS
fig|585161.3.peg.2398 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Doubtful CDS
fig|585891.3.peg.2611 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Doubtful CDS
fig|644279.4.peg.2679 Staphylococcus aureus subsp. aureus 132 FIG   Doubtful CDS
fig|680649.3.peg.303 Staphylococcus aureus subsp. aureus MR1 FIG   Doubtful CDS
fig|681288.4.peg.2559 Staphylococcus aureus subsp. aureus ED98 FIG   Doubtful CDS
fig|703339.3.peg.2527 Staphylococcus aureus 04-02981 FIG   Doubtful CDS
fig|762962.3.peg.1976 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Doubtful CDS
fig|93061.3.peg.2687 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Doubtful CDS
fig|93061.5.peg.2567 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Doubtful CDS
fig|93062.19.peg.2475 Staphylococcus aureus subsp. aureus COL FIG   Doubtful CDS
fig|93062.4.peg.2589 Staphylococcus aureus subsp. aureus COL FIG   Doubtful CDS
gb|AAW37318.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD31838.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50330.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_2553
gb|ABR53428.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEW45696.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0434
gb|EEW46392.1 Staphylococcus aureus D30     hypothetical protein SAD30_1313
gi|147742032 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2553
gi|148268963 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2553
gi|149947492 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150375440 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150395040 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_2605
gi|151222640 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2428
gi|21205622 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21284179 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2450
gi|259160674 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0434
gi|259161805 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1313
gi|49245751 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49487308 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS2415a
gi|57285224 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651038 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2542
gi|87204028 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196470 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02837
img|637153287 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637158686 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637300267 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637895444 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639107423 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640566938 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640780715 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640796859 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|sac:SACOL2542 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2428 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_2605 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_2553 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW2450 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02837 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2415a   KEGG   hypothetical protein
ref|NP_647267.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2450
ref|YP_001247906.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_2553
ref|YP_001317715.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_2605
ref|YP_001333462.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2428
ref|YP_044529.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS2415a
ref|YP_187334.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2542
ref|YP_501295.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02837
tr|A5IVV7 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QK18 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6U4R0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|Q2FV97 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HD23 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G6E5 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NUS7 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW2450


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search