The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2602: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Transcriptional regulator SarU (Staphylococcal accessory regulator U)
Translate Function Assignments



Context on contig NC_009641 from base 2627840 to 2639397 (11558 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2600 2632339 2627840 4500 -       1: 1   Virulence-associated cell-wall-anchored protein SasG (LPXTG motif), binding to squamous nasal epithelial cells locus|NWMN_2392, protein_id|YP_001333426.1, gi|151222604, geneID|5331474
2601 2633000 2632644 357 - 304         Transcriptional regulator SarT (Staphylococcal accessory regulator T) gene_name|sarT, locus|NWMN_2393, protein_id|YP_001333427.1, gi|151222605, geneID|5331475
2602 2633324 2634067 744 + 323         Transcriptional regulator SarU (Staphylococcal accessory regulator U) gene_name|sarU, locus|NWMN_2394, protein_id|YP_001333428.1, gi|151222606, geneID|5332437
2603 2635144 2634278 867 - 210     1: 2   UTP---glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) gene_name|gtaB, locus|NWMN_2395, protein_id|YP_001333429.1, gi|151222607, geneID|5332438
2604 2635893 2635324 570 - 179     1: 1   Fibronectin binding protein FnbB locus|NWMN_2396, protein_id|YP_001333430.1, gi|151222608, geneID|5331979
2605 2638077 2636113 1965 - 219     1: 1   Fibronectin binding protein FnbB gene_name|fnbB, locus|NWMN_2397, protein_id|YP_001333431.1, gi|151222609, geneID|5331476
2606 2639397 2638828 570 - 750     1: 1   Fibronectin binding protein FnbB locus|NWMN_2398, protein_id|YP_001333432.1, gi|151222610, geneID|5331918

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2602 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
KPRKFFF

MD5 = 491d0d068f9aebb794f775b1172871b3


  DNA Sequence

>fig|426430.8.peg.2602 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
gtggactatcaaactttcgaaaaggtcaataaattcataaatgtaaaagcgtacatattt
tttctcactcaagagttaaagcaacaatataaattatcattaaaagaattgttgatatta
gcatatttttattacaaaaatgaacacagtatttcactaaaagaaatcattggtgacata
ctttacaaacaatctgatgttgtaaagaacattaagtcactatctaaaaaaggatttata
aataagtctagaaacgaagcagatgaacgccgtatttttgtttcagttactccaatacaa
cgtaaaaagattgcttgtgttattaatgagttagataaaataattaaaggatttaataag
gaaagagactacataaaatatcaatgggctccaaaatatagcaaagaattttttatactt
tttatgaacattatgtactcaaaagattttttaaaatatcgatttaatttaacatttctt
gatttatctatcttatatgtaatatcatctcgaaaaaatgagatactaaatttaaaagat
ttgtttgaaagtattagatttatgtatcctcaaattgttaggtcagttaatagattaaat
aataaaggtatgctaatcaaagaacgatcccttgcagatgaaaggattgtgttaatcaaa
ataaataaaatacaatataacactattaaaagcatattcacagatacttccaagattctc
aaaccaagaaaatttttcttttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2602 Transcriptional regulator SarU (Staphylococcal accessory regulator U)
tataatgtctctcataaaatatttaccttcatcatttttaaatacatctaaatatgctaa
tactaaataattatctaatgtaagacaaaaatatttttttaaatatttacgcagctcata
tgtagttaatactcttttcattaatttaatattgctcttgcttttcaaatcattcatcaa
gtcttcatcccttacttttaattgtcacgtcaaataatatttgtctttaactagtaataa
ctccaaatatatttagtttgtggtgctagctataaacacaaatgaatcataacactatat
tttgattttgttcaattgtttttatttttggataataaatgaatttgtcatttgttattc
tgtgatttttagttatttatattttatatatattatatataaaaatatttaggttaacat
gtcttcaaaagagattgcttttatattactttaaataatataaagtattgggacatcaga
aaatagtaggagaatgtaaggtggactatcaaactttcgaaaaggtcaataaattcataa
atgtaaaagcgtacatattttttctcactcaagagttaaagcaacaatataaattatcat
taaaagaattgttgatattagcatatttttattacaaaaatgaacacagtatttcactaa
aagaaatcattggtgacatactttacaaacaatctgatgttgtaaagaacattaagtcac
tatctaaaaaaggatttataaataagtctagaaacgaagcagatgaacgccgtatttttg
tttcagttactccaatacaacgtaaaaagattgcttgtgttattaatgagttagataaaa
taattaaaggatttaataaggaaagagactacataaaatatcaatgggctccaaaatata
gcaaagaattttttatactttttatgaacattatgtactcaaaagattttttaaaatatc
gatttaatttaacatttcttgatttatctatcttatatgtaatatcatctcgaaaaaatg
agatactaaatttaaaagatttgtttgaaagtattagatttatgtatcctcaaattgtta
ggtcagttaatagattaaataataaaggtatgctaatcaaagaacgatcccttgcagatg
aaaggattgtgttaatcaaaataaataaaatacaatataacactattaaaagcatattca
cagatacttccaagattctcaaaccaagaaaatttttcttttaaatttaaacagatttac
ctcttgataaaataaataagcaatcatactacttctcaatttagtataaataaaaataca
taattaactttcttttgtttttatattatttcaataccctactatatatcacaacacata
aattaagcatgacactcattcaatttagttcaccatttcgtgttccaattttactgagta
tcatgcttttaatgttataaacctaatgctttaataaatcgtgttaattcttctcgcata
ctgtcatctttcaatgcatattctatggtagttttaacgaagcctaatttttctccaacg
tcataacgttcgccttcgaagtcatatgcatacacttggttatcattattcatacgttca
atcgcatctgttaactgaatttcgttacctgcgccttctttttgcgtttttaaataatcg
aaaatttcaggcgttaatacataacgtcccataatagctaggtttgatggtgccgtacct
tgtg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005737       C:cytoplasm
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0009405       P:pathogenesis
cmr|SACOL2507 Staphylococcus aureus subsp. aureus COL     staphylococcal accessory regulator U
dbj|BAF68666.1 Staphylococcus aureus subsp. aureus str. Newman     staphylococcal accessory regulator U
fig|426430.6.peg.2317 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|93062.19.peg.2442 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator SarU (Staphylococcal accessory regulator U)
fig|93062.4.peg.2557 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator SarU (Staphylococcal accessory regulator U)
gb|AAG45334.2 Staphylococcus aureus     rot-like protein Rlp
gb|AAW37286.1 Staphylococcus aureus subsp. aureus COL     staphylococcal accessory regulator U
gb|AF288788_1 Staphylococcus aureus     rot-like protein Rlp
gi|13661993 Staphylococcus aureus NCBI   rot-like protein Rlp
gi|150375406 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal accessory regulator U
gi|151222606 Staphylococcus aureus subsp. aureus str. Newman NCBI   staphylococcal accessory regulator U
gi|57285192 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcal accessory regulator U
gi|57651006 Staphylococcus aureus subsp. aureus COL NCBI   staphylococcal accessory regulator U
gi|81324408 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarU; AltName: Full=Staphylococcal accessory regulator U
gi|81693738 organism not parsed/found in ncbi nr NCBI   RecName: Full=HTH-type transcriptional regulator sarU; AltName: Full=Staphylococcal accessory regulator U
img|637153255 Staphylococcus aureus aureus COL IMG   staphylococcal accessory regulator U
img|640796825 Staphylococcus aureus aureus Newman IMG   staphylococcal accessory regulator U
kegg|sac:SACOL2507 Staphylococcus aureus subsp. aureus COL KEGG   staphylococcal accessory regulator U
kegg|sae:NWMN_2394 Staphylococcus aureus subsp. aureus Newman KEGG   staphylococcal accessory regulator U
ref|YP_001333428.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   staphylococcal accessory regulator U
ref|YP_187302.1 Staphylococcus aureus subsp. aureus COL RefSeq   staphylococcal accessory regulator U
sp|Q5HD55 Staphylococcus aureus (strain COL) SwissProt   HTH-type transcriptional regulator sarU
sp|Q9EZK4 Staphylococcus aureus SwissProt   HTH-type transcriptional regulator sarU
sp|SARU_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarU; AltName: Full=Staphylococcal accessory regulator U
sp|SARU_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=HTH-type transcriptional regulator sarU; AltName: Full=Staphylococcal accessory regulator U
tr|A6QJY4 Staphylococcus aureus (strain Newman) TrEMBL   Staphylococcal accessory regulator U


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search