The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2565: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
Translate Function Assignments



Context on contig NC_009641 from base 2588755 to 2600675 (11921 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2559 2589531 2588755 777 -       1: 1   YbbM seven transmembrane helix protein locus|NWMN_2352, protein_id|YP_001333386.1, gi|151222564, geneID|5331440
2560 2590186 2589524 663 - -8     1: 1   YbbL ABC transporter ATP-binding protein locus|NWMN_2353, protein_id|YP_001333387.1, gi|151222565, geneID|5331441
2561 2591510 2590434 1077 - 247         M42 glutamyl aminopeptidase, cellulase locus|NWMN_2354, protein_id|YP_001333388.1, gi|151222566, geneID|5331442
2562 2592131 2591865 267 - 354         FIG01108728: hypothetical protein  
2563 2592388 2592131 258 - -1         YefM protein (antitoxin to YoeB) gene_name|stbD, locus|NWMN_2355, protein_id|YP_001333389.1, gi|151222567, geneID|5331443
2564 2592747 2593202 456 + 358         FIG01108263: hypothetical protein locus|NWMN_2356, protein_id|YP_001333390.1, gi|151222568, geneID|5332513
2565 2594947 2593370 1578 - 167     3: 3 5 6   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1) locus|NWMN_2357, protein_id|YP_001333391.1, gi|151222569, geneID|5331444
2566 2595142 2595891 750 + 194         FIG01108156: hypothetical protein locus|NWMN_2358, protein_id|YP_001333392.1, gi|151222570, geneID|5331445
2567 2597308 2596115 1194 - 223     2: 4 2   Staphylopine exporter, MFS-family locus|NWMN_2359, protein_id|YP_001333393.1, gi|151222571, geneID|5331446
2568 2598069 2597320 750 - 11         Oligopeptide transporter putative ATPase domain gene_name|opp1F, locus|NWMN_2360, protein_id|YP_001333394.1, gi|151222572, geneID|5331447
2569 2598877 2598062 816 - -8         Oligopeptide transporter putative ATPase domain gene_name|opp1D, locus|NWMN_2361, protein_id|YP_001333395.1, gi|151222573, geneID|5332222
2570 2599743 2598874 870 - -4         Staphylopine-metal ABC transporter, permease protein CntC gene_name|opp1C, locus|NWMN_2362, protein_id|YP_001333396.1, gi|151222574, geneID|5332221
2571 2600675 2599740 936 - -4         Oligopeptide transporter putative membrane permease domain gene_name|opp1B, locus|NWMN_2363, protein_id|YP_001333397.1, gi|151222575, geneID|5332220

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ammonia_assimilation OlgaZ Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
Glutamine,_Glutamate,_Aspartate_and_Asparagine_Biosynthesis OlgaZ Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
Glutamate,_Glutamine,_Aspartate,_and_Asparagine_biosynthesis_PanGenomes Acharya_Geeta_user Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)


  Protein Sequence

>fig|426430.8.peg.2565 Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS

MD5 = 708519a39ca113664eb40d0bc931a4c9


  DNA Sequence

>fig|426430.8.peg.2565 Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
atgacgtttcttacagtcatgcaatttatagttaacattatcgttgtaggattcatgctt
acggttattgttatcgggcttatttggttaattaaagataaaagacaatcacaacatagt
gtattaaggaattatcctttactagcacgtattagatatatttcagaaaaaatgggaccg
gaattacgtcagtatttattttctggggataatgaagggaaacctttttcacgtaatgat
tataaaaatatcgttttggctggaaaatataactctcgtatgaccagcttcggtactact
aaagattatcaagacggcttttacatacagaacacaatgtttccgatgcaacgtaatgag
atttcagtagataatacaacattgttatcaacattcatttataaaatcgcgaatgagcgt
ttatttagtcgtgaagaatatcgtgtgccgacaaagattgatccgtattacttaagtgat
gaccatgcaataaaattaggtgaacatttaaaacatccatttattttaaaacgtatcgta
ggacaatctggtatgagttatggcgctttaggaaaaaatgccattacagctttatctaaa
ggtctagctaaagcgggcacttggatgaatacaggtgaaggtggcttatcagaatatcat
ttaaaaggtaatggggatatcattttccaaattggtcccggtttatttggtgttcgtgat
aaagaaggtaattttagtgaaggtttatttaaagaggttgcacagttatctaacgtacgc
gcatttgagctgaagttggcacaaggtgctaagactcgtggtggtcatatggaagctgaa
aaggtaaacgaagaaattgctaaaatccgaaatgttgaaccttataaaacaatcaattca
cctaaccgttacgaatttattcataatgctgaagatttgattcgtttcgtcgatcagttg
cagcaattaggtcaaaaaccagtaggattcaaaattgtagtaagcaaagtttcagaaatt
gaaacacttgtacgtacgatggtggaactagataagtatccaagctttattacgattgat
ggtggtgaaggtggtactggtgcaacattccaagaattacaagatggtgttggcttaccg
ctatttacagctctacctattgtgtctggcatgttagaaaaatatggtattcgagataaa
gtgaaattggcggcatctggtaagttagtgacaccagataaaattgcgattgcactaggt
ttaggtgcagattttgtaaatatcgcacgtgggatgatgattagtgtcggttgtataatg
agtcaacaatgtcacatgaatacgtgtcctgtaggtgttgcaacgacagatgcgaagaaa
gaaaaagcattgattgttggagaaaagcaatatcgtgtcacaaactatgtaacaagtttg
catgaaggcttattcaatattgcagcagctgttggcgtatccagtcctacagaaattact
gctgatcatattgtatatcgaaaagtcgatggtgagttacaaacgatacatgattataaa
ttaaaactcattagttaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2565 Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
agcactagcaacgatttgcgaacgtatcattggaataaacgcatcttcatgcatcagacg
aaaaatagctagtgaaataataactgcgagtaaatagctaatgttcattgaaataggaaa
agagaaaccccacggagcttgttgagtgaatacagctactaacccaaaagttaaaaagac
gataatgatcggcaagatgttaaccaaaaatatgtaaaggaaaataaatccaatatcacg
tttgaaaaaacgcgattgttcggtagcgtattcttcttctatgtaatgtttatttgtatt
tgacatagtatacctcttaaatagttgtattatatagatactttagcacatattactttg
tattgtatgttttatacattaaaatttaaaatgaaaaacatatcataaaattgttttata
aaatgaagcgcttccattgtgttttgttttgtaaggtgtatcataaatattgaattgaaa
ttttggggggaggtattgtaatgacgtttcttacagtcatgcaatttatagttaacatta
tcgttgtaggattcatgcttacggttattgttatcgggcttatttggttaattaaagata
aaagacaatcacaacatagtgtattaaggaattatcctttactagcacgtattagatata
tttcagaaaaaatgggaccggaattacgtcagtatttattttctggggataatgaaggga
aacctttttcacgtaatgattataaaaatatcgttttggctggaaaatataactctcgta
tgaccagcttcggtactactaaagattatcaagacggcttttacatacagaacacaatgt
ttccgatgcaacgtaatgagatttcagtagataatacaacattgttatcaacattcattt
ataaaatcgcgaatgagcgtttatttagtcgtgaagaatatcgtgtgccgacaaagattg
atccgtattacttaagtgatgaccatgcaataaaattaggtgaacatttaaaacatccat
ttattttaaaacgtatcgtaggacaatctggtatgagttatggcgctttaggaaaaaatg
ccattacagctttatctaaaggtctagctaaagcgggcacttggatgaatacaggtgaag
gtggcttatcagaatatcatttaaaaggtaatggggatatcattttccaaattggtcccg
gtttatttggtgttcgtgataaagaaggtaattttagtgaaggtttatttaaagaggttg
cacagttatctaacgtacgcgcatttgagctgaagttggcacaaggtgctaagactcgtg
gtggtcatatggaagctgaaaaggtaaacgaagaaattgctaaaatccgaaatgttgaac
cttataaaacaatcaattcacctaaccgttacgaatttattcataatgctgaagatttga
ttcgtttcgtcgatcagttgcagcaattaggtcaaaaaccagtaggattcaaaattgtag
taagcaaagtttcagaaattgaaacacttgtacgtacgatggtggaactagataagtatc
caagctttattacgattgatggtggtgaaggtggtactggtgcaacattccaagaattac
aagatggtgttggcttaccgctatttacagctctacctattgtgtctggcatgttagaaa
aatatggtattcgagataaagtgaaattggcggcatctggtaagttagtgacaccagata
aaattgcgattgcactaggtttaggtgcagattttgtaaatatcgcacgtgggatgatga
ttagtgtcggttgtataatgagtcaacaatgtcacatgaatacgtgtcctgtaggtgttg
caacgacagatgcgaagaaagaaaaagcattgattgttggagaaaagcaatatcgtgtca
caaactatgtaacaagtttgcatgaaggcttattcaatattgcagcagctgttggcgtat
ccagtcctacagaaattactgctgatcatattgtatatcgaaaagtcgatggtgagttac
aaacgatacatgattataaattaaaactcattagttaacttaattatttcgggaaattga
aagcagcggattttagcgttactgcaaataattttatattagtagtggatgctggtcaca
caagaacttcaaatattaaagccctcagaatatgaattaaggtttgtaaccttagtctta
tctgagggcatttttaagttataaactatttgtcgtccattttatctttttcttttaaac
ctctgtgctttaattgcttttcaagtttttcaaaactaatatctttattttctttagtcg
aaacaccaagacgtttatttaattttttcatgtcaacttctgtgtaatctatgtctaagt
gttcaattgcttttttatctttatagtctactttgtattttacgcctttaaggtctttga
aaatactttcagatttggcgaataactttttggcttcgtctttatccatacctagatcgt
catatttaattgtgttgattgtagactgttttaaaactttatcatctttatatgtgat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004355       F:glutamate synthase (NADPH) activity
GO:0006537       P:glutamate biosynthetic process
GO:0015930       F:glutamate synthase activity
GO:0055114       P:oxidation reduction
cmr|NT05SA2478 Staphylococcus aureus NCTC 8325     ferredoxin-dependent glutamate synthase
cmr|SACOL2469 Staphylococcus aureus subsp. aureus COL     glutamate synthase-related protein
cmr|SAUSA300_2404 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF68629.1 Staphylococcus aureus subsp. aureus str. Newman     ferredoxin-dependent glutamate synthase
fig|367830.3.peg.726 Staphylococcus aureus subsp. aureus USA300 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|426430.6.peg.2283 Staphylococcus aureus subsp. aureus str. Newman FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|451515.3.peg.2566 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|451516.9.peg.2556 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|452948.4.peg.1842 Staphylococcus aureus 930918-3 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|455227.3.peg.1994 Staphylococcus aureus D30 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|546342.3.peg.1362 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|546343.3.peg.419 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|553567.3.peg.718 Staphylococcus aureus A5948 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|553583.3.peg.2546 Staphylococcus aureus A9635 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|553590.4.peg.1069 Staphylococcus aureus A9754 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|553594.3.peg.420 Staphylococcus aureus A9765 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|644279.4.peg.2607 Staphylococcus aureus subsp. aureus 132 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|93061.3.peg.2611 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|93061.5.peg.2495 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
fig|93062.4.peg.2521 Staphylococcus aureus subsp. aureus COL FIG   Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)
gb|AAW38557.1 Staphylococcus aureus subsp. aureus COL     glutamate synthase-related protein
gb|ABD21280.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD31764.1 Staphylococcus aureus subsp. aureus NCTC 8325     glutamate synthase alpha subunit, putative
gb|ABX30440.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glutamate synthase (NADPH)
gb|EEV68877.1 Staphylococcus aureus A9635     ferredoxin-dependent glutamate synthase
gb|EEV83841.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150375369 Staphylococcus aureus subsp. aureus str. Newman NCBI   ferredoxin-dependent glutamate synthase
gi|151222569 Staphylococcus aureus subsp. aureus str. Newman NCBI   ferredoxin-dependent glutamate synthase
gi|160369469 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glutamate synthase (NADPH)
gi|161510660 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glutamate synthase (NADPH)
gi|221138348 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glutamate synthase (NADPH)
gi|221140411 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glutamate synthase (NADPH)
gi|257844834 Staphylococcus aureus A9635 NCBI   ferredoxin-dependent glutamate synthase
gi|257861026 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258425000 Staphylococcus aureus A9635 NCBI   ferredoxin-dependent glutamate synthase
gi|258451234 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57286463 Staphylococcus aureus subsp. aureus COL NCBI   glutamate synthase-related protein
gi|57652277 Staphylococcus aureus subsp. aureus COL NCBI   glutamate synthase-related protein
gi|87126766 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160792 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2404
gi|87203954 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamate synthase alpha subunit, putative
gi|88196396 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamate synthase alpha subunit, putative
img|637153219 Staphylococcus aureus aureus COL IMG   glutamate synthase-related protein
img|637889047 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637895368 Staphylococcus aureus aureus NCTC 8325 IMG   glutamate synthase alpha subunit, putative( EC:1.4.1.13 )
img|640796788 Staphylococcus aureus aureus Newman IMG   ferredoxin-dependent glutamate synthase
img|641310454 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glutamate synthase (NADPH)( EC:1.4.1.13 )
img|641773563 Staphylococcus aureus aureus USA300_TCH959 IMG   glutamate synthase (NADPH)
kegg|saa:SAUSA300_2404 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2469 Staphylococcus aureus subsp. aureus COL KEGG   glutamate synthase-related protein
kegg|sae:NWMN_2357 Staphylococcus aureus subsp. aureus Newman KEGG   ferredoxin-dependent glutamate synthase
kegg|sao:SAOUHSC_02760 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   glutamate synthase alpha subunit, putative (EC:1.4.1.13)
kegg|sax:USA300HOU_2450 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glutamate synthase (NADPH) (EC:1.4.1.13)
ref|YP_001333391.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   ferredoxin-dependent glutamate synthase
ref|YP_001576319.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glutamate synthase (NADPH)
ref|YP_187266.1 Staphylococcus aureus subsp. aureus COL RefSeq   glutamate synthase-related protein
ref|YP_495039.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2404
ref|YP_501219.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   glutamate synthase alpha subunit, putative
ref|ZP_03563150.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glutamate synthase (NADPH)
ref|ZP_03564904.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glutamate synthase (NADPH)
ref|ZP_05687871.1 Staphylococcus aureus A9635 RefSeq   ferredoxin-dependent glutamate synthase
ref|ZP_05699267.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJU7 Staphylococcus aureus (strain Newman) TrEMBL   Ferredoxin-dependent glutamate synthase
tr|A8YYL6 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Glutamate synthase (NADPH)
tr|Q2FE39 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FVF4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Glutamate synthase alpha subunit, putative
tr|Q5HD91 Staphylococcus aureus (strain COL) TrEMBL   Glutamate synthase-related protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search