The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2510: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Protein-disulfide isomerase, related to DsbA
Translate Function Assignments



Context on contig NC_009641 from base 2530440 to 2542050 (11611 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2503 2530976 2530440 537 -           Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294         FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74         Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 1   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417
2516 2542050 2540713 1338 - 120         FIG01107989: hypothetical protein locus|NWMN_2314, protein_id|YP_001333348.1, gi|151222526, geneID|5331418

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2510 Protein-disulfide isomerase, related to DsbA
MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
VEDPYDYESYEKLLKDKIK

MD5 = 678e5ff5ef79d7eef5e120a1c748fc30


  DNA Sequence

>fig|426430.8.peg.2510 Protein-disulfide isomerase, related to DsbA
atgactaaaaaattactaacattatttatagtgagcatgttaattttaacagcttgcggt
aaaaaagaatcagcaacgacatcttcgaaaaacggcaaaccattagttgtcgtatatggc
gactataaatgtccttattgtaaagaattagatgaaaaagtcatgccaaagttgcgtaaa
aattatatagataatcacaaagtggaataccaatttgtcaatttagctttcttaggtaaa
gactcaattgttggttcgcgtgcgagtcatgcagtattgatgtatgcacctaaatcattt
ttagattttcaaaagcaattatttgctgcccagcaagatgaaaataaagaatggttaaca
aaagaactattagataaacatattaaacaactgcatttagataaagagacggaaaataaa
attataaaagattacaagacaaaagatagcaagtcttggaaagctgcagagaaagataaa
aaaatagcgaaagataatcatataaaaacgacaccaactgcatttattaatggcgagaaa
gttgaagatccatatgattatgaaagttatgagaagttattaaaagataaaatcaaatag


  DNA with Flanking Sequence

>fig|426430.8.peg.2510 Protein-disulfide isomerase, related to DsbA
atttctttggatatttatattaaatgcattggtagtagttgtagcgcattaatgtttgac
ggtgtatagtattaattatattgaaagttagttggaagttgatagtaggagtgggagcat
tgaagcgatttgtggcgacggtattattattactagtctttatatcaggatgtggtaatg
ataaatatgtgaaagaaatagatgaagcagttaaaattcaaaatcaaaaacaagaacaac
ttgccaaaaaaggcaacggtgatcgtgttgatcattttgaacgcaaagatgctaatattt
atgtctatgataaggataaaattatcattttagcttataaacctttgagtaatgatgatg
aagtgcattattatgcatatgattttagtgataaacgtgtatcatataagcaagattttg
attcgagacgatattatcaacaacatgatgcggattatcatgaagaaaatatgacgaact
agatatgaataggagttattatgactaaaaaattactaacattatttatagtgagcatgt
taattttaacagcttgcggtaaaaaagaatcagcaacgacatcttcgaaaaacggcaaac
cattagttgtcgtatatggcgactataaatgtccttattgtaaagaattagatgaaaaag
tcatgccaaagttgcgtaaaaattatatagataatcacaaagtggaataccaatttgtca
atttagctttcttaggtaaagactcaattgttggttcgcgtgcgagtcatgcagtattga
tgtatgcacctaaatcatttttagattttcaaaagcaattatttgctgcccagcaagatg
aaaataaagaatggttaacaaaagaactattagataaacatattaaacaactgcatttag
ataaagagacggaaaataaaattataaaagattacaagacaaaagatagcaagtcttgga
aagctgcagagaaagataaaaaaatagcgaaagataatcatataaaaacgacaccaactg
catttattaatggcgagaaagttgaagatccatatgattatgaaagttatgagaagttat
taaaagataaaatcaaatagtcttaattgttgagatcagtaagtgataccaatttattag
gacaatacgaaaaggcaatttctattagcgatatgatagagattgtctttttaatgtatg
aagtctaaataggtggaaattatcatgtaaacattgtttagtagggaatcagtacaggat
aggtattgattcttccccgtgcgaaatcttgattagtagtttttttctgtgtcgcttgtt
ttattgtacagatatttgtacaattgaggtgtgttaaaagagggcgataaatatgattat
taaaaattattcatacgctcgacagaatttaaaggcacttatgacaaaagtaaatgatga
tagtgatatggtaactgtaacatctactgatgataaaaacgtagtaatcatgtcagaatc
agattataactccatgatggaaacactttacctccaacagaacccaaataatgctgaaca
cttagctcaatcaattgcagatctagaacgtgggaaaact


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016853       F:isomerase activity
cmr|NT05SA2429 Staphylococcus aureus NCTC 8325     lipoprotein, putative
cmr|SACOL2407 Staphylococcus aureus subsp. aureus COL     lipoprotein, putative
cmr|SAUSA300_2354 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative lipoprotein
dbj|BAF68580.1 Staphylococcus aureus subsp. aureus str. Newman     protein-disulfide isomerase
fig|367830.3.peg.440 Staphylococcus aureus subsp. aureus USA300 FIG   Protein-disulfide isomerase, related to DsbA
fig|426430.6.peg.2235 Staphylococcus aureus subsp. aureus str. Newman FIG   Protein-disulfide isomerase, related to DsbA
fig|451515.3.peg.2512 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Protein-disulfide isomerase, related to DsbA
fig|451516.9.peg.2501 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Protein-disulfide isomerase, related to DsbA
fig|452948.4.peg.544 Staphylococcus aureus 930918-3 FIG   Protein-disulfide isomerase, related to DsbA
fig|455227.3.peg.801 Staphylococcus aureus D30 FIG   Protein-disulfide isomerase, related to DsbA
fig|546342.3.peg.1515 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Protein-disulfide isomerase, related to DsbA
fig|546343.3.peg.1343 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Protein-disulfide isomerase, related to DsbA
fig|553567.3.peg.772 Staphylococcus aureus A5948 FIG   Protein-disulfide isomerase, related to DsbA
fig|553590.4.peg.1015 Staphylococcus aureus A9754 FIG   Protein-disulfide isomerase, related to DsbA
fig|553594.3.peg.366 Staphylococcus aureus A9765 FIG   Protein-disulfide isomerase, related to DsbA
fig|644279.4.peg.2552 Staphylococcus aureus subsp. aureus 132 FIG   Protein-disulfide isomerase, related to DsbA
fig|93061.3.peg.2548 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Protein-disulfide isomerase, related to DsbA
fig|93061.5.peg.2440 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Protein-disulfide isomerase, related to DsbA
fig|93062.19.peg.2350 Staphylococcus aureus subsp. aureus COL FIG   Protein-disulfide isomerase, related to DsbA
fig|93062.4.peg.2464 Staphylococcus aureus subsp. aureus COL FIG   Protein-disulfide isomerase, related to DsbA
gb|AAG41993.1 Staphylococcus aureus     disulfide bond protein A
gb|AAW37232.1 Staphylococcus aureus subsp. aureus COL     lipoprotein, putative
gb|ABD21498.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative lipoprotein
gb|ABD31702.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX30380.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible lipoprotein
gb|AF321274_1 Staphylococcus aureus     disulfide bond protein A
gb|EEV83893.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45569.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1330
gb|EEW47636.1 Staphylococcus aureus D30     hypothetical protein SAD30_0664
gi|11935158 Staphylococcus aureus NCBI   disulfide bond protein A
gi|150375320 Staphylococcus aureus subsp. aureus str. Newman NCBI   protein-disulfide isomerase
gi|151222520 Staphylococcus aureus subsp. aureus str. Newman NCBI   protein-disulfide isomerase
gi|160369409 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible lipoprotein
gi|161510600 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lipoprotein
gi|221138492 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   lipoprotein
gi|221141313 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   lipoprotein
gi|257861078 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451286 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160546 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1330
gi|259163075 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0664
gi|57285138 Staphylococcus aureus subsp. aureus COL NCBI   lipoprotein, putative
gi|57650952 Staphylococcus aureus subsp. aureus COL NCBI   putative lipoprotein
gi|87126984 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipoprotein
gi|87161010 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipoprotein
gi|87203892 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196334 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02694
img|637153163 Staphylococcus aureus aureus COL IMG   lipoprotein, putative
img|637888997 Staphylococcus aureus aureus USA300 IMG   putative lipoprotein
img|637895305 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640796739 Staphylococcus aureus aureus Newman IMG   protein-disulfide isomerase
img|641310394 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible lipoprotein
img|641773045 Staphylococcus aureus aureus USA300_TCH959 IMG   possible lipoprotein
kegg|saa:SAUSA300_2354 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative lipoprotein
kegg|sac:SACOL2407 Staphylococcus aureus subsp. aureus COL KEGG   putative lipoprotein
kegg|sae:NWMN_2308 Staphylococcus aureus subsp. aureus Newman KEGG   protein-disulfide isomerase
kegg|sao:SAOUHSC_02694 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2390 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   lipoprotein
ref|YP_001333342.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   protein-disulfide isomerase
ref|YP_001576259.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   lipoprotein
ref|YP_187210.1 Staphylococcus aureus subsp. aureus COL RefSeq   putative lipoprotein
ref|YP_494989.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative lipoprotein
ref|YP_501156.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02694
ref|ZP_03563294.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   lipoprotein
ref|ZP_03565806.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   lipoprotein
ref|ZP_05699319.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QJP8 Staphylococcus aureus (strain Newman) TrEMBL   Protein-disulfide isomerase
tr|A8Z597 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible lipoprotein
tr|Q2FE89 Staphylococcus aureus (strain USA300) TrEMBL   Putative lipoprotein
tr|Q2FVL7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HDE7 Staphylococcus aureus (strain COL) TrEMBL   Lipoprotein, putative
tr|Q9EYL5 Staphylococcus aureus TrEMBL   Disulfide bond protein A precursor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search