The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2508: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108752: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 2529479 to 2540592 (11114 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2502 2530210 2529479 732 -       1: 1   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294       FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74 17     Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 2   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
MVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCK
YHY

MD5 = 808e5e17ae581943b9213368d021cacc


  DNA Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
atggtgaagaagattaatgagttacttaaaagtattgacagaaatggtgcattggaaggt
ataggtaagcctgaaaagttaaaatcgaatctgactgggtattatagtagacgtatcaat
cacgaacatagattggtttatacagtagatgacaatcatataaaaatagcatcatgtaaa
taccattattaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
tgaagtctaaataggtggaaattatcatgtaaacattgtttagtagggaatcagtacagg
ataggtattgattcttccccgtgcgaaatcttgattagtagtttttttctgtgtcgcttg
ttttattgtacagatatttgtacaattgaggtgtgttaaaagagggcgataaatatgatt
attaaaaattattcatacgctcgacagaatttaaaggcacttatgacaaaagtaaatgat
gatagtgatatggtaactgtaacatctactgatgataaaaacgtagtaatcatgtcagaa
tcagattataactccatgatggaaacactttacctccaacagaacccaaataatgctgaa
cacttagctcaatcaattgcagatctagaacgtgggaaaactataacgaaagatatagat
gtataatggctaggttaaatattacgttttcgcctcaagcctttgaagattataagtatt
ttcagcagaacgataaaaaaatggtgaagaagattaatgagttacttaaaagtattgaca
gaaatggtgcattggaaggtataggtaagcctgaaaagttaaaatcgaatctgactgggt
attatagtagacgtatcaatcacgaacatagattggtttatacagtagatgacaatcata
taaaaatagcatcatgtaaataccattattaaatctaaaagtcacactataaaaataggg
taagttattttaggacaatatgaaaaggcaatttctattagcaatatgatagagattgtc
tttttttcttatattatgacgttcgtaaatactataaagttttctgtatcatatttgtac
aatagtcatgtattagataaaacgaaaagtggtaaatacctaaagtatgattcgacttta
tattatttataaaaacagtgcttgtattttaagtagcatgagtatataattttaaaacgt
aaagattactatttaggagggtgactatgaaaaagaaattaggtatgttacttcttgtac
cagccgtaactttatcattagccgcatgtgggaatgatgatggaaaagataaagatggca
aggtaacaattaaaacgacagtttatccattgcaatcatttgcagagcaaattggtggaa
aacacgtgaaggtatcatcaatctatccagcagggacagatttacatagcta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004519       F:endonuclease activity
GO:0006401       P:RNA catabolic process
cmr|NT05SA2427 Staphylococcus aureus NCTC 8325     addiction module toxin, Txe/YoeB family
fig|158878.14.peg.2491 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108752: hypothetical protein
fig|158879.11.peg.2380 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108752: hypothetical protein
fig|196620.5.peg.2406 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108752: hypothetical protein
fig|282459.5.peg.2390 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108752: hypothetical protein
fig|359786.13.peg.2571 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108752: hypothetical protein
fig|359786.3.peg.1521 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108752: hypothetical protein
fig|359787.3.peg.668 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108752: hypothetical protein
fig|450394.6.peg.2191 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01108752: hypothetical protein
fig|452948.4.peg.546 Staphylococcus aureus 930918-3 FIG   FIG01108752: hypothetical protein
fig|455227.3.peg.803 Staphylococcus aureus D30 FIG   FIG01108752: hypothetical protein
fig|505321.3.peg.193 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108752: hypothetical protein
fig|546342.3.peg.1513 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108752: hypothetical protein
fig|546343.3.peg.1345 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108752: hypothetical protein
fig|548474.3.peg.471 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108752: hypothetical protein
fig|548475.3.peg.1760 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108752: hypothetical protein
fig|553567.3.peg.774 Staphylococcus aureus A5948 FIG   FIG01108752: hypothetical protein
fig|553568.3.peg.2739 Staphylococcus aureus A6224 FIG   FIG01108752: hypothetical protein
fig|553573.3.peg.799 Staphylococcus aureus A8115 FIG   FIG01108752: hypothetical protein
fig|553577.3.peg.236 Staphylococcus aureus A8796 FIG   FIG01108752: hypothetical protein
fig|553580.3.peg.237 Staphylococcus aureus A8819 FIG   FIG01108752: hypothetical protein
fig|553581.3.peg.2485 Staphylococcus aureus A9299 FIG   FIG01108752: hypothetical protein
fig|553588.3.peg.2575 Staphylococcus aureus A9719 FIG   FIG01108752: hypothetical protein
fig|553590.4.peg.1013 Staphylococcus aureus A9754 FIG   FIG01108752: hypothetical protein
fig|553592.3.peg.552 Staphylococcus aureus A9763 FIG   FIG01108752: hypothetical protein
fig|553594.3.peg.364 Staphylococcus aureus A9765 FIG   FIG01108752: hypothetical protein
fig|553601.3.peg.1903 Staphylococcus aureus A10102 FIG   FIG01108752: hypothetical protein
fig|585891.3.peg.2485 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108752: hypothetical protein
fig|680649.3.peg.2663 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108752: hypothetical protein
fig|681288.4.peg.2434 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108752: hypothetical protein
fig|703339.3.peg.2395 Staphylococcus aureus 04-02981 FIG   FIG01108752: hypothetical protein
fig|762962.3.peg.2101 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108752: hypothetical protein
fig|93061.5.peg.2438 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108752: hypothetical protein
gb|ABR53303.1 Staphylococcus aureus subsp. aureus JH1     addiction module toxin, Txe/YoeB family
gi|149947367 Staphylococcus aureus subsp. aureus JH1 NCBI   addiction module toxin, Txe/YoeB family
gi|150394915 Staphylococcus aureus subsp. aureus JH1 NCBI   addiction module antitoxin
img|639109482 Staphylococcus aureus aureus JH1 IMG   Addiction module toxin, Txe/YoeB
img|640780590 Staphylococcus aureus aureus JH1 IMG   addiction module toxin, Txe/YoeB family
kegg|sah:SaurJH1_2479 Staphylococcus aureus subsp. aureus JH1 KEGG   addiction module antitoxin
ref|YP_001317590.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   addiction module antitoxin
tr|A6U4D5 Staphylococcus aureus (strain JH1) TrEMBL   Addiction module toxin, Txe/YoeB family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
17 fig|426430.8.peg.2509 Antitoxin DinJ (binds YafQ toxin)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search