The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2508: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108752: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 2529479 to 2540592 (11114 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2502 2530210 2529479 732 -       1: 1   Sirohydrochlorin ferrochelatase (EC 4.99.1.4) gene_name|nirR, locus|NWMN_2301, protein_id|YP_001333335.1, gi|151222513, geneID|5332204
2503 2530976 2530440 537 - 229         Uncharacterized N-acetyltransferase YtmI locus|NWMN_2302, protein_id|YP_001333336.1, gi|151222514, geneID|5332206
2504 2532033 2531209 825 - 232         formate/nitrite transporter family protein locus|NWMN_2303, protein_id|YP_001333337.1, gi|151222515, geneID|5331409
2505 2532432 2532250 183 - 216         FIG01107855: hypothetical protein locus|NWMN_2304, protein_id|YP_001333338.1, gi|151222516, geneID|5331410
2506 2532983 2532516 468 - 83         Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) locus|NWMN_2305, protein_id|YP_001333339.1, gi|151222517, geneID|5331411
2507 2534718 2533123 1596 - 139         Candidate zinc-binding lipoprotein ZinT locus|NWMN_2306, protein_id|YP_001333340.1, gi|151222518, geneID|5331412
2508 2535204 2535013 192 - 294       FIG01108752: hypothetical protein locus|NWMN_2307, protein_id|YP_001333341.1, gi|151222519, geneID|5331413
2509 2535530 2535279 252 - 74 17     Antitoxin DinJ (binds YafQ toxin)  
2510 2536402 2535803 600 - 272         Protein-disulfide isomerase, related to DsbA gene_name|dsbA, locus|NWMN_2308, protein_id|YP_001333342.1, gi|151222520, geneID|5331414
2511 2536783 2536421 363 - 18         FIG01108076: hypothetical protein locus|NWMN_2309, protein_id|YP_001333343.1, gi|151222521, geneID|5331881
2512 2537038 2538288 1251 + 254         FmhA protein of FemAB family gene_name|fmhA, locus|NWMN_2310, protein_id|YP_001333344.1, gi|151222522, geneID|5331415
2513 2539116 2538385 732 - 96     1: 2   L-cystine ABC transporter, ATP-binding protein TcyC locus|NWMN_2311, protein_id|YP_001333345.1, gi|151222523, geneID|5331911
2514 2539832 2539113 720 - -4         amino acid ABC transporter, permease protein locus|NWMN_2312, protein_id|YP_001333346.1, gi|151222524, geneID|5331416
2515 2540592 2539813 780 - -20         L-Cystine ABC transporter, periplasmic cystine-binding protein TcyA locus|NWMN_2313, protein_id|YP_001333347.1, gi|151222525, geneID|5331417

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
MVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCK
YHY

MD5 = 808e5e17ae581943b9213368d021cacc


  DNA Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
atggtgaagaagattaatgagttacttaaaagtattgacagaaatggtgcattggaaggt
ataggtaagcctgaaaagttaaaatcgaatctgactgggtattatagtagacgtatcaat
cacgaacatagattggtttatacagtagatgacaatcatataaaaatagcatcatgtaaa
taccattattaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2508 FIG01108752: hypothetical protein
tgaagtctaaataggtggaaattatcatgtaaacattgtttagtagggaatcagtacagg
ataggtattgattcttccccgtgcgaaatcttgattagtagtttttttctgtgtcgcttg
ttttattgtacagatatttgtacaattgaggtgtgttaaaagagggcgataaatatgatt
attaaaaattattcatacgctcgacagaatttaaaggcacttatgacaaaagtaaatgat
gatagtgatatggtaactgtaacatctactgatgataaaaacgtagtaatcatgtcagaa
tcagattataactccatgatggaaacactttacctccaacagaacccaaataatgctgaa
cacttagctcaatcaattgcagatctagaacgtgggaaaactataacgaaagatatagat
gtataatggctaggttaaatattacgttttcgcctcaagcctttgaagattataagtatt
ttcagcagaacgataaaaaaatggtgaagaagattaatgagttacttaaaagtattgaca
gaaatggtgcattggaaggtataggtaagcctgaaaagttaaaatcgaatctgactgggt
attatagtagacgtatcaatcacgaacatagattggtttatacagtagatgacaatcata
taaaaatagcatcatgtaaataccattattaaatctaaaagtcacactataaaaataggg
taagttattttaggacaatatgaaaaggcaatttctattagcaatatgatagagattgtc
tttttttcttatattatgacgttcgtaaatactataaagttttctgtatcatatttgtac
aatagtcatgtattagataaaacgaaaagtggtaaatacctaaagtatgattcgacttta
tattatttataaaaacagtgcttgtattttaagtagcatgagtatataattttaaaacgt
aaagattactatttaggagggtgactatgaaaaagaaattaggtatgttacttcttgtac
cagccgtaactttatcattagccgcatgtgggaatgatgatggaaaagataaagatggca
aggtaacaattaaaacgacagtttatccattgcaatcatttgcagagcaaattggtggaa
aacacgtgaaggtatcatcaatctatccagcagggacagatttacatagcta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004519       F:endonuclease activity
GO:0006401       P:RNA catabolic process
cmr|NT05SA2427 Staphylococcus aureus NCTC 8325     addiction module toxin, Txe/YoeB family
fig|158878.14.peg.2491 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108752: hypothetical protein
fig|158879.11.peg.2380 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108752: hypothetical protein
fig|196620.5.peg.2406 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108752: hypothetical protein
fig|282459.5.peg.2390 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108752: hypothetical protein
fig|359786.13.peg.2571 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108752: hypothetical protein
fig|359786.3.peg.1521 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108752: hypothetical protein
fig|359787.3.peg.668 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108752: hypothetical protein
fig|450394.6.peg.2191 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01108752: hypothetical protein
fig|452948.4.peg.546 Staphylococcus aureus 930918-3 FIG   FIG01108752: hypothetical protein
fig|455227.3.peg.803 Staphylococcus aureus D30 FIG   FIG01108752: hypothetical protein
fig|505321.3.peg.193 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108752: hypothetical protein
fig|546342.3.peg.1513 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01108752: hypothetical protein
fig|546343.3.peg.1345 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01108752: hypothetical protein
fig|548474.3.peg.471 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108752: hypothetical protein
fig|548475.3.peg.1760 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108752: hypothetical protein
fig|553567.3.peg.774 Staphylococcus aureus A5948 FIG   FIG01108752: hypothetical protein
fig|553568.3.peg.2739 Staphylococcus aureus A6224 FIG   FIG01108752: hypothetical protein
fig|553573.3.peg.799 Staphylococcus aureus A8115 FIG   FIG01108752: hypothetical protein
fig|553577.3.peg.236 Staphylococcus aureus A8796 FIG   FIG01108752: hypothetical protein
fig|553580.3.peg.237 Staphylococcus aureus A8819 FIG   FIG01108752: hypothetical protein
fig|553581.3.peg.2485 Staphylococcus aureus A9299 FIG   FIG01108752: hypothetical protein
fig|553588.3.peg.2575 Staphylococcus aureus A9719 FIG   FIG01108752: hypothetical protein
fig|553590.4.peg.1013 Staphylococcus aureus A9754 FIG   FIG01108752: hypothetical protein
fig|553592.3.peg.552 Staphylococcus aureus A9763 FIG   FIG01108752: hypothetical protein
fig|553594.3.peg.364 Staphylococcus aureus A9765 FIG   FIG01108752: hypothetical protein
fig|553601.3.peg.1903 Staphylococcus aureus A10102 FIG   FIG01108752: hypothetical protein
fig|585891.3.peg.2485 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108752: hypothetical protein
fig|680649.3.peg.2663 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108752: hypothetical protein
fig|681288.4.peg.2434 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108752: hypothetical protein
fig|703339.3.peg.2395 Staphylococcus aureus 04-02981 FIG   FIG01108752: hypothetical protein
fig|762962.3.peg.2101 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108752: hypothetical protein
fig|93061.5.peg.2438 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108752: hypothetical protein
gb|ABR53303.1 Staphylococcus aureus subsp. aureus JH1     addiction module toxin, Txe/YoeB family
gi|149947367 Staphylococcus aureus subsp. aureus JH1 NCBI   addiction module toxin, Txe/YoeB family
gi|150394915 Staphylococcus aureus subsp. aureus JH1 NCBI   addiction module antitoxin
img|639109482 Staphylococcus aureus aureus JH1 IMG   Addiction module toxin, Txe/YoeB
img|640780590 Staphylococcus aureus aureus JH1 IMG   addiction module toxin, Txe/YoeB family
kegg|sah:SaurJH1_2479 Staphylococcus aureus subsp. aureus JH1 KEGG   addiction module antitoxin
ref|YP_001317590.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   addiction module antitoxin
tr|A6U4D5 Staphylococcus aureus (strain JH1) TrEMBL   Addiction module toxin, Txe/YoeB family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
17 fig|426430.8.peg.2509 Antitoxin DinJ (binds YafQ toxin)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search