The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2480: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: AraC family regulatory protein
Translate Function Assignments



Context on contig NC_009641 from base 2501066 to 2514469 (13404 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2476 2501066 2501689 624 +       1: 2   Transcriptional regulator, AcrR family locus|NWMN_2277, protein_id|YP_001333311.1, gi|151222489, geneID|5331391
2477 2501735 2502679 945 + 45     1: 3   Magnesium and cobalt transport protein CorA locus|NWMN_2278, protein_id|YP_001333312.1, gi|151222490, geneID|5331392
2478 2504207 2502765 1443 - 85     1: 7   PTS system, sucrose-specific IIB component (EC 2.7.1.69) / PTS system, sucrose-specific IIC component (EC 2.7.1.69) locus|NWMN_2279, protein_id|YP_001333313.1, gi|151222491, geneID|5331393
2479 2504390 2504773 384 + 182         Probable type II DNA modification enzyme locus|NWMN_2280, protein_id|YP_001333314.1, gi|151222492, geneID|5331394
2480 2506258 2508363 2106 + 1484         AraC family regulatory protein locus|NWMN_2281, protein_id|YP_001333315.1, gi|151222493, geneID|5331395
2481 2508434 2508856 423 + 70         General stress protein 26 locus|NWMN_2282, protein_id|YP_001333316.1, gi|151222494, geneID|5331396
2482 2509121 2509477 357 + 264         FIG01108504: hypothetical protein locus|NWMN_2283, protein_id|YP_001333317.1, gi|151222495, geneID|5331397
2483 2511158 2509881 1278 - 403     1: 6   Proton/glutamate symport protein @ Sodium/glutamate symport protein locus|NWMN_2284, protein_id|YP_001333318.1, gi|151222496, geneID|5331398
2484 2511705 2511340 366 - 181         FIG01108216: hypothetical protein locus|NWMN_2285, protein_id|YP_001333319.1, gi|151222497, geneID|5331399
2485 2512103 2512549 447 + 397         Transcriptional regulator SarZ (Staphylococcal accessory regulator Z) locus|NWMN_2286, protein_id|YP_001333320.1, gi|151222498, geneID|5331400
2486 2512756 2513193 438 + 206         Molecular chaperone, small heat shock protein locus|NWMN_2287, protein_id|YP_001333321.1, gi|151222499, geneID|5331401
2487 2514469 2513300 1170 - 106     3: 4 1 5   Nitrate/nitrite transporter locus|NWMN_2288, protein_id|YP_001333322.1, gi|151222500, geneID|5331402

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2480 AraC family regulatory protein
MTCQLKIHHTLSTIPSRNINNIMVLFSLTSKLNITINGETKDVSNYIILINHGDIYNINH
GENIIELMIPVFYFYQQDDDFFNGYLDRHLLQSSNYIKSLIADLISTPTSSSLMGKNIGQ
SIIDTLLKEAFIRIDHEYLPNIALSNPVFIDCVNYIHDNIDAHLSLKDIAMHCNISESYC
SNLFVRYLSMNFKDYFTSIKLVNAINLLLSTKHSITTVSELAGFNSHTNFANQFKNYLHF
SPKQFRSLVSKITEPPQIHFQQDNVSQFTELISTIDLTAQLATNTTDIHIDDFNPKDRSQ
RAKVFVRFSNFNELFQFIFNEYYDINFEHLPKPVVFIDDIHDIEISQTNYNLLNRCFEKL
FEKNIGLAIAIKSTQQFETMKQLILTFLQGNQDYKTSKKLVKFMLVFCSNSMTAEEIHLC
HLKIKNKNKEIKYSVTVDGFLETYSTVEQVYDVMQRLKFHYYFIDIENSKTATHLITKNQ
HYHQTDTHFEQYKKFILDSGISSTQFVYNNLSVSGFKYTNDGKNPIQLSDIVYHLIALLR
YGGGISYQLLDDHSNYISLYNKYGSPLPLMHLYKMFRPFVNEDIEITNNYVLSRKDNNYH
FLLFNKINDRYMSDVKQDFIFHNELPQDSLMIIKTLNHEHGSIQHLLPISDQLVYIEKEI
LDELDKTNYPKTELAVQEETGRTFELKLNHDEVKYICFKPS

MD5 = 0cc986dfb5aadf0975726dc5aa05e0ac


  DNA Sequence

>fig|426430.8.peg.2480 AraC family regulatory protein
atgacatgccaacttaaaatacatcatacattatcgacaataccaagtcgtaatattaat
aatattatggtgctattttcacttacaagtaaactcaatattacgattaatggtgaaacc
aaagacgtaagtaattatattatcttaattaaccatggtgatatttataatattaaccac
ggcgaaaatataatcgaattaatgatacccgttttttatttttatcaacaagatgatgat
ttctttaatggttatttagatcgtcatttattacaatcaagtaattatattaagtcatta
attgctgatttaatcagtacaccaacaagttcttctttaatggggaaaaatataggtcaa
agtattatagacactttacttaaagaagcttttataagaatagatcatgaatatttacca
aatattgctttaagcaatccggtgttcatagactgtgtaaactatattcatgacaatatt
gatgcgcacttgtctttaaaagatatagcgatgcattgcaacatctctgaatcatattgt
tctaatctttttgttcgatatttgagtatgaattttaaagattattttacaagtattaaa
cttgttaacgccatcaatttattactttctacaaaacattctattacaactgtttctgaa
ttggccggttttaacagtcatacaaattttgcaaatcaatttaagaattacttgcatttt
agtcctaaacagttccgttcactcgtttccaagattactgaaccaccacaaatacacttc
caacaagataacgtatcacaattcactgagttaatttcaacaattgatttaacagctcaa
ctggctacaaatacaacagatattcatatagatgattttaatccgaaagatcgaagtcag
cgtgccaaagtatttgttcgatttagtaatttcaatgaactatttcaatttattttcaat
gaatattacgatattaactttgagcacttaccaaaacctgtcgttttcattgacgatatt
cacgatattgagattagccaaacgaattacaacctgttaaatagatgttttgaaaagctt
ttcgaaaaaaatataggtttagcaatcgctattaaatcaacacaacaattcgaaacgatg
aagcaattaatactaacatttttacaaggcaatcaagactataagacaagcaagaaatta
gttaaatttatgctcgtattttgctctaattctatgacagcagaagaaattcatttatgt
catcttaaaattaaaaacaaaaataaagaaattaaatatagtgtgacagtcgatggcttt
ttagaaacttattcaaccgtggaacaagtttatgatgtcatgcagcgtcttaaattccat
tattactttattgatattgaaaattcaaaaactgcaacacatcttatcactaaaaaccaa
cactatcatcaaactgacactcattttgaacagtataagaaatttattttagattcaggt
atatcatcaacacaatttgtatataataacctgtctgtaagcggatttaaatatactaat
gatggtaagaatccaattcaattatctgacatagtgtatcacttaatcgcattattacga
tatggcggtggcattagctatcaattattagatgaccattcaaattatatttccttgtac
aacaaatatggtagccccctaccattaatgcatttatataaaatgtttagaccttttgtt
aatgaagatattgaaattacaaataattatgtattgagtcgtaaagataataactaccat
ttcttattattcaataaaattaatgatcgatatatgtcagacgtaaaacaagatttcatt
ttccataatgaattacctcaagactctttgatgattattaaaacattgaatcatgaacat
ggttcaattcaacatttgcttccaataagcgatcaacttgtttatatagaaaaagaaatt
ttagatgaattagacaaaacgaattaccctaaaacggagcttgcagttcaagaagaaact
ggtcgtacatttgaactcaagttaaatcacgacgaggttaaatatatttgctttaaacca
agctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2480 AraC family regulatory protein
caagaagtgatttcaatcgtactaattttcagcgtttgatgacaaaagtgtatgtccaaa
cttaaataatggcgataaaatttaagtcatgggtacatttaatgttttttgattcaaact
tccattttggtcaatttgctttttttataacatagttgaatatcaataaaagattagcaa
gttagttcaaaatggctatgtattgttttttgaaatacataggtttgaaatctatattaa
ttatgcaccaaataatttaattagactctatcgaaaatttccaaattttgcttactatct
ttctaattttacttttatattgtgcgcaatgcataaaaacaagcgttttcctaggagttt
tcattaatttcttttatttttcactattaccttttcaaaaatattcaactataataggta
tactatccatgattttaaaaatttccatgttttacatttaaatgatagatttcaatatat
attaggcaggagagagaaatatgacatgccaacttaaaatacatcatacattatcgacaa
taccaagtcgtaatattaataatattatggtgctattttcacttacaagtaaactcaata
ttacgattaatggtgaaaccaaagacgtaagtaattatattatcttaattaaccatggtg
atatttataatattaaccacggcgaaaatataatcgaattaatgatacccgttttttatt
tttatcaacaagatgatgatttctttaatggttatttagatcgtcatttattacaatcaa
gtaattatattaagtcattaattgctgatttaatcagtacaccaacaagttcttctttaa
tggggaaaaatataggtcaaagtattatagacactttacttaaagaagcttttataagaa
tagatcatgaatatttaccaaatattgctttaagcaatccggtgttcatagactgtgtaa
actatattcatgacaatattgatgcgcacttgtctttaaaagatatagcgatgcattgca
acatctctgaatcatattgttctaatctttttgttcgatatttgagtatgaattttaaag
attattttacaagtattaaacttgttaacgccatcaatttattactttctacaaaacatt
ctattacaactgtttctgaattggccggttttaacagtcatacaaattttgcaaatcaat
ttaagaattacttgcattttagtcctaaacagttccgttcactcgtttccaagattactg
aaccaccacaaatacacttccaacaagataacgtatcacaattcactgagttaatttcaa
caattgatttaacagctcaactggctacaaatacaacagatattcatatagatgatttta
atccgaaagatcgaagtcagcgtgccaaagtatttgttcgatttagtaatttcaatgaac
tatttcaatttattttcaatgaatattacgatattaactttgagcacttaccaaaacctg
tcgttttcattgacgatattcacgatattgagattagccaaacgaattacaacctgttaa
atagatgttttgaaaagcttttcgaaaaaaatataggtttagcaatcgctattaaatcaa
cacaacaattcgaaacgatgaagcaattaatactaacatttttacaaggcaatcaagact
ataagacaagcaagaaattagttaaatttatgctcgtattttgctctaattctatgacag
cagaagaaattcatttatgtcatcttaaaattaaaaacaaaaataaagaaattaaatata
gtgtgacagtcgatggctttttagaaacttattcaaccgtggaacaagtttatgatgtca
tgcagcgtcttaaattccattattactttattgatattgaaaattcaaaaactgcaacac
atcttatcactaaaaaccaacactatcatcaaactgacactcattttgaacagtataaga
aatttattttagattcaggtatatcatcaacacaatttgtatataataacctgtctgtaa
gcggatttaaatatactaatgatggtaagaatccaattcaattatctgacatagtgtatc
acttaatcgcattattacgatatggcggtggcattagctatcaattattagatgaccatt
caaattatatttccttgtacaacaaatatggtagccccctaccattaatgcatttatata
aaatgtttagaccttttgttaatgaagatattgaaattacaaataattatgtattgagtc
gtaaagataataactaccatttcttattattcaataaaattaatgatcgatatatgtcag
acgtaaaacaagatttcattttccataatgaattacctcaagactctttgatgattatta
aaacattgaatcatgaacatggttcaattcaacatttgcttccaataagcgatcaacttg
tttatatagaaaaagaaattttagatgaattagacaaaacgaattaccctaaaacggagc
ttgcagttcaagaagaaactggtcgtacatttgaactcaagttaaatcacgacgaggtta
aatatatttgctttaaaccaagctaaatactaacagtcctcttgtgtttagtttcttacg
ttaaaggctatttatatcataaggagatgatttgtaatgagtaactcacaagcaattcaa
gcaattgaaaacgtgttagcaacgtcaaaagttggtgtattatcaactgcatataataat
aaacctaatagtagatatatggtcttttataatgatggtcttactttatatactaaaacg
aatatccattctgctaaggtcaaagaaattaaagataatccagcagcatatgttttgtta
ggctataacgacacaactaatcgtagtttcgttgagatggaagcgacaatcgaaatcgtt
acagaacaagaagtgattgattggctatgggaaacacaagacaaaagctttttcagttca
aaagaagacccagagttatgtgttttaagagtagttccgcaatccattaagctaatgaat
gataaatcattagatacacctatcaaaatcgatttataacacaaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005622       C:intracellular
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0043565       F:sequence-specific DNA binding
cmr|NT01SA2395 Staphylococcus aureus N315     transcriptional regulator, araC family domain protein
cmr|NT02SA2380 Staphylococcus aureus Mu50     transcription regulatory protein
cmr|NT05SA2400 Staphylococcus aureus NCTC 8325     AraC family regulatory protein
cmr|SACOL2378 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, AraC family
cmr|SAUSA300_2326 Staphylococcus aureus subsp. aureus USA300-FPR3757     transcription regulatory protein
dbj|BAB43471.1 Staphylococcus aureus subsp. aureus N315     SA2169
dbj|BAB58543.1 Staphylococcus aureus subsp. aureus Mu50     similar to transcription regulatory protein
dbj|BAF68553.1 Staphylococcus aureus subsp. aureus str. Newman     transcriptional regulator AraC family protein
dbj|BAF79248.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2381 Staphylococcus aureus subsp. aureus Mu50 FIG   AraC family regulatory protein
fig|158878.14.peg.2464 Staphylococcus aureus subsp. aureus Mu50 FIG   AraC family regulatory protein
fig|158879.1.peg.2254 Staphylococcus aureus subsp. aureus N315 FIG   AraC family regulatory protein
fig|158879.11.peg.2354 Staphylococcus aureus subsp. aureus N315 FIG   AraC family regulatory protein
fig|359786.13.peg.2544 Staphylococcus aureus subsp. aureus JH9 FIG   AraC family regulatory protein
fig|359786.3.peg.646 Staphylococcus aureus subsp. aureus JH9 FIG   AraC family regulatory protein
fig|359787.11.peg.2506 Staphylococcus aureus subsp. aureus JH1 FIG   AraC family regulatory protein
fig|359787.3.peg.1514 Staphylococcus aureus subsp. aureus JH1 FIG   AraC family regulatory protein
fig|367830.3.peg.344 Staphylococcus aureus subsp. aureus USA300 FIG   AraC family regulatory protein
fig|418127.4.peg.2185 Staphylococcus aureus subsp. aureus Mu3 FIG   AraC family regulatory protein
fig|418127.6.peg.2428 Staphylococcus aureus subsp. aureus Mu3 FIG   AraC family regulatory protein
fig|426430.6.peg.2210 Staphylococcus aureus subsp. aureus str. Newman FIG   AraC family regulatory protein
fig|450394.6.peg.1881 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   AraC family regulatory protein
fig|451515.3.peg.2483 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   AraC family regulatory protein
fig|451516.9.peg.2472 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   AraC family regulatory protein
fig|452948.4.peg.574 Staphylococcus aureus 930918-3 FIG   AraC family regulatory protein
fig|455227.3.peg.830 Staphylococcus aureus D30 FIG   AraC family regulatory protein
fig|505321.3.peg.167 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   AraC family regulatory protein
fig|548474.3.peg.495 Staphylococcus aureus subsp. aureus TCH130 FIG   AraC family regulatory protein
fig|553565.3.peg.2021 Staphylococcus aureus A5937 FIG   AraC family regulatory protein
fig|553567.3.peg.801 Staphylococcus aureus A5948 FIG   AraC family regulatory protein
fig|553568.3.peg.2712 Staphylococcus aureus A6224 FIG   AraC family regulatory protein
fig|553573.3.peg.773 Staphylococcus aureus A8115 FIG   AraC family regulatory protein
fig|553574.3.peg.1170 Staphylococcus aureus A8117 FIG   AraC family regulatory protein
fig|553577.3.peg.209 Staphylococcus aureus A8796 FIG   AraC family regulatory protein
fig|553580.3.peg.211 Staphylococcus aureus A8819 FIG   AraC family regulatory protein
fig|553581.3.peg.2511 Staphylococcus aureus A9299 FIG   AraC family regulatory protein
fig|553588.3.peg.2601 Staphylococcus aureus A9719 FIG   AraC family regulatory protein
fig|553590.4.peg.986 Staphylococcus aureus A9754 FIG   AraC family regulatory protein
fig|553592.3.peg.525 Staphylococcus aureus A9763 FIG   AraC family regulatory protein
fig|553594.3.peg.337 Staphylococcus aureus A9765 FIG   AraC family regulatory protein
fig|553596.3.peg.1629 Staphylococcus aureus A9781 FIG   AraC family regulatory protein
fig|553601.3.peg.1877 Staphylococcus aureus A10102 FIG   AraC family regulatory protein
fig|585891.3.peg.2459 Staphylococcus aureus subsp. aureus Mu50-omega FIG   AraC family regulatory protein
fig|644279.4.peg.2523 Staphylococcus aureus subsp. aureus 132 FIG   AraC family regulatory protein
fig|680649.3.peg.1730 Staphylococcus aureus subsp. aureus MR1 FIG   AraC family regulatory protein
fig|703339.3.peg.2369 Staphylococcus aureus 04-02981 FIG   AraC family regulatory protein
fig|93061.3.peg.2518 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   AraC family regulatory protein
fig|93061.5.peg.2410 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   AraC family regulatory protein
fig|93062.19.peg.2321 Staphylococcus aureus subsp. aureus COL FIG   AraC family regulatory protein
fig|93062.4.peg.2437 Staphylococcus aureus subsp. aureus COL FIG   AraC family regulatory protein
gb|AAW37204.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, AraC family
gb|ABD21797.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     transcription regulatory protein
gb|ABD31672.1 Staphylococcus aureus subsp. aureus NCTC 8325     transcriptional regulator, putative
gb|ABQ50185.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, AraC family
gb|ABR53277.1 Staphylococcus aureus subsp. aureus JH1     helix-turn-helix- domain containing protein AraC type
gb|ABX30355.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     AraC transcriptional regulator
gb|EES96626.1 Staphylococcus aureus subsp. aureus TCH130     AraC transcriptional regulator
gb|EEV27033.1 Staphylococcus aureus A9781     transcriptional regulator
gb|EEV65364.1 Staphylococcus aureus A9763     transcriptional regulator
gb|EEV66139.1 Staphylococcus aureus A9719     transcription regulatory protein
gb|EEV71441.1 Staphylococcus aureus A9299     transcriptional regulator
gb|EEV75835.1 Staphylococcus aureus A8115     transcriptional regulator AraC family protein
gb|EEV79364.1 Staphylococcus aureus A6224     AraC transcriptional regulator
gb|EEV83922.1 Staphylococcus aureus A5948     transcription regulatory protein
gb|EEV85240.1 Staphylococcus aureus A5937     transcription regulatory protein
gi|13702330 Staphylococcus aureus subsp. aureus N315 NCBI   SA2169
gi|14248155 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to transcription regulatory protein
gi|147741887 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, AraC family
gi|148268818 Staphylococcus aureus subsp. aureus JH9 NCBI   helix-turn-helix domain-containing protein
gi|149947341 Staphylococcus aureus subsp. aureus JH1 NCBI   helix-turn-helix- domain containing protein AraC type
gi|150375293 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator AraC family protein
gi|150394889 Staphylococcus aureus subsp. aureus JH1 NCBI   helix-turn-helix domain-containing protein
gi|151222493 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional regulator AraC family protein
gi|156722831 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980696 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2365
gi|15925371 Staphylococcus aureus subsp. aureus Mu50 NCBI   transcription regulatory protein
gi|15927959 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2169
gi|160369384 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   AraC transcriptional regulator
gi|161510575 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   AraC transcriptional regulator
gi|253314718 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   transcription regulatory protein
gi|253727897 Staphylococcus aureus subsp. aureus TCH130 NCBI   AraC transcriptional regulator
gi|253734202 Staphylococcus aureus subsp. aureus TCH130 NCBI   AraC transcriptional regulator
gi|255007155 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   transcription regulatory protein
gi|257788693 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257794721 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257840913 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|257841702 Staphylococcus aureus A9719 NCBI   transcription regulatory protein
gi|257847439 Staphylococcus aureus A9299 NCBI   transcriptional regulator
gi|257851901 Staphylococcus aureus A8115 NCBI   transcriptional regulator AraC family protein
gi|257856455 Staphylococcus aureus A6224 NCBI   AraC transcriptional regulator
gi|257861107 Staphylococcus aureus A5948 NCBI   transcription regulatory protein
gi|257862472 Staphylococcus aureus A5937 NCBI   transcription regulatory protein
gi|258407401 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|258422271 Staphylococcus aureus A9719 NCBI   transcription regulatory protein
gi|258439663 Staphylococcus aureus A9299 NCBI   transcriptional regulator
gi|258442780 Staphylococcus aureus A8115 NCBI   transcriptional regulator AraC family protein
gi|258450363 Staphylococcus aureus A6224 NCBI   AraC transcriptional regulator
gi|258451315 Staphylococcus aureus A5948 NCBI   transcription regulatory protein
gi|258455261 Staphylococcus aureus A5937 NCBI   transcription regulatory protein
gi|57285110 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator, AraC family
gi|57650924 Staphylococcus aureus subsp. aureus COL NCBI   AraC family transcriptional regulator
gi|87127283 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcription regulatory protein
gi|87161309 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcription regulatory protein
gi|87203862 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transcriptional regulator, putative
gi|88196304 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transcriptional regulator, putative
img|637093922 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100938 Staphylococcus aureus aureus Mu50 IMG   similar to transcription regulatory protein
img|637153135 Staphylococcus aureus aureus COL IMG   transcriptional regulator, AraC family
img|637888969 Staphylococcus aureus aureus USA300 IMG   transcription regulatory protein
img|637895275 Staphylococcus aureus aureus NCTC 8325 IMG   transcriptional regulator, putative
img|639109804 Staphylococcus aureus aureus JH1 IMG   Helix-turn-helix, AraC type
img|640566793 Staphylococcus aureus aureus JH9 IMG   helix-turn-helix- domain containing protein, AraC type
img|640780564 Staphylococcus aureus aureus JH1 IMG   helix-turn-helix- domain containing protein AraC type
img|640796712 Staphylococcus aureus aureus Newman IMG   transcriptional regulator AraC family protein
img|640905163 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310369 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   AraC transcriptional regulator
img|641772904 Staphylococcus aureus aureus USA300_TCH959 IMG   AraC transcriptional regulator
kegg|saa:SAUSA300_2326 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   transcription regulatory protein
kegg|sac:SACOL2378 Staphylococcus aureus subsp. aureus COL KEGG   AraC family transcriptional regulator
kegg|sae:NWMN_2281 Staphylococcus aureus subsp. aureus Newman KEGG   transcriptional regulator AraC family protein
kegg|sah:SaurJH1_2452 Staphylococcus aureus subsp. aureus JH1 KEGG   helix-turn-helix domain-containing protein
kegg|saj:SaurJH9_2405 Staphylococcus aureus subsp. aureus JH9 KEGG   helix-turn-helix domain-containing protein
kegg|sao:SAOUHSC_02664 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   transcriptional regulator, putative
kegg|sau:SA2169   KEGG   hypothetical protein
kegg|sav:SAV2381   KEGG   transcription regulatory protein
kegg|saw:SAHV_2365 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2364 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   AraC transcriptional regulator
ref|NP_372905.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   transcription regulatory protein
ref|NP_375492.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2169
ref|YP_001247761.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   helix-turn-helix domain-containing protein
ref|YP_001317564.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   helix-turn-helix domain-containing protein
ref|YP_001333315.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   transcriptional regulator AraC family protein
ref|YP_001442955.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2365
ref|YP_001576234.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   AraC transcriptional regulator
ref|YP_187182.1 Staphylococcus aureus subsp. aureus COL RefSeq   AraC family transcriptional regulator
ref|YP_494961.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   transcription regulatory protein
ref|YP_501126.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   transcriptional regulator, putative
ref|ZP_04837931.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   transcription regulatory protein
ref|ZP_04868367.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   AraC transcriptional regulator
ref|ZP_05145756.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   transcription regulatory protein
ref|ZP_05643700.1 Staphylococcus aureus A9781 RefSeq   transcriptional regulator
ref|ZP_05680544.1 Staphylococcus aureus A9763 RefSeq   transcriptional regulator
ref|ZP_05685183.1 Staphylococcus aureus A9719 RefSeq   transcription regulatory protein
ref|ZP_05690409.1 Staphylococcus aureus A9299 RefSeq   transcriptional regulator
ref|ZP_05691340.1 Staphylococcus aureus A8115 RefSeq   transcriptional regulator AraC family protein
ref|ZP_05698455.1 Staphylococcus aureus A6224 RefSeq   AraC transcriptional regulator
ref|ZP_05699348.1 Staphylococcus aureus A5948 RefSeq   transcription regulatory protein
ref|ZP_05703221.1 Staphylococcus aureus A5937 RefSeq   transcription regulatory protein
tr|A5IVG2 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, AraC family
tr|A6QJM1 Staphylococcus aureus (strain Newman) TrEMBL   Transcriptional regulator AraC family protein
tr|A6U4A9 Staphylococcus aureus (strain JH1) TrEMBL   Helix-turn-helix-domain containing protein AraC type
tr|A7X609 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z572 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   AraC transcriptional regulator
tr|C5Q2J8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   AraC transcriptional regulator
tr|Q2FEB7 Staphylococcus aureus (strain USA300) TrEMBL   Transcription regulatory protein
tr|Q2FVN8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Transcriptional regulator, putative
tr|Q5HDH5 Staphylococcus aureus (strain COL) TrEMBL   Transcriptional regulator, AraC family
tr|Q7A3V5 Staphylococcus aureus (strain N315) TrEMBL   SA2169 protein
tr|Q99RP8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to transcription regulatory protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search