The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2468: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: hypothetical protein similar to TpgX
Translate Function Assignments



Context on contig NC_009641 from base 2488988 to 2500905 (11918 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2465 2490466 2488988 1479 -       3: 16 15 4   Malate:quinone oxidoreductase (EC 1.1.5.4) gene_name|mqo, locus|NWMN_2267, protein_id|YP_001333301.1, gi|151222479, geneID|5331382
2466 2492445 2490847 1599 - 380         L-lactate permease locus|NWMN_2268, protein_id|YP_001333302.1, gi|151222480, geneID|5332161
2467 2492747 2494435 1689 + 301     1: 7   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis locus|NWMN_2269, protein_id|YP_001333303.1, gi|151222481, geneID|5331383
2468 2495217 2494588 630 - 152         hypothetical protein similar to TpgX locus|NWMN_2270, protein_id|YP_001333304.1, gi|151222482, geneID|5331384
2469 2496046 2495531 516 - 313         N1-spermidine/spermine acetyltransferase PaiA locus|NWMN_2271, protein_id|YP_001333305.1, gi|151222483, geneID|5331385
2470 2496237 2497241 1005 + 190     7: 14 9 12 13 11 8 10   Acryloyl-CoA reductase AcuI/YhdH (EC 1.3.1.84) locus|NWMN_2272, protein_id|YP_001333306.1, gi|151222484, geneID|5331386
2471 2497688 2497287 402 - 45         Attachment to host cells and virulence locus|NWMN_2273, protein_id|YP_001333307.1, gi|151222485, geneID|5331387
2472 2498758 2497724 1035 - 35     6: 6 3 17 5 2 1   Thioredoxin reductase (EC 1.8.1.9) locus|NWMN_2274, protein_id|YP_001333308.1, gi|151222486, geneID|5331388
2473 2498885 2498769 117 - 10         hypothetical protein  
2474 2499421 2498990 432 - 104         FIG01108300: hypothetical protein locus|NWMN_2275, protein_id|YP_001333309.1, gi|151222487, geneID|5331389
2475 2500905 2499628 1278 - 206         Phage infection protein locus|NWMN_2276, protein_id|YP_001333310.1, gi|151222488, geneID|5331390

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.2468 hypothetical protein similar to TpgX
MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSK
DVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPV
ARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSF
KDPNANGKYSIVTVDYTGQAMVTDPNYQQ

MD5 = b0880fa894d5ba76ca4f4d154e8e1441


  DNA Sequence

>fig|426430.8.peg.2468 hypothetical protein similar to TpgX
atgaaaagattagttacagggttactagcattatcattatttttagctgcatgtggtcaa
gatagtgaccaacaaaaagacggtaataaagaaaaagatgataaagcgaaaactgaacaa
caagataaaaaaacaaatgattcatctaaagataagaaagataataaagatgatagtaaa
gacgtaaacaaagataataaagataatagtgcaaacgataaccagcaacaatctaattca
aatgcaacaaacaatgaccaaaaccaaacaaataataaccaatcaagtaataaccaagcg
aataataatcaaaaatcaagttacgttgcaccatattatggacaaaatgccgcgccggtt
gcacgtcaaatttatccgtttaatggaaataaaaatcaagctttacagcaattgccaaat
ttccaaacagctttaaatgcggctaataatgaagcaaataaatttggtagtaataataaa
gtgtataatgattattctattgaagaacataatggcaactataagtatgtgtttagtttt
aaagacccaaatgcaaatggaaaatattcaattgtaacggttgattatactggacaagca
atggttactgatccaaactaccaacaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2468 hypothetical protein similar to TpgX
attgatagaattggccgaaaaaattgctcaagaacataataaacataaaatttggctagg
agtttgggagcataatcctcgtgctcaagcattttataaacgtcatggatttaaagtggt
tggtgaacatcattttcaaacaggtgatgtaacggatacagatttaattatggaaaaaga
gttataatgattgtttttgcagcagataaaatgaaatcatagtaataaatattgtgtata
ccttgaaatgctaaatgcgtaatgaattgttaaagtaaaataattaaatttatagaaaac
ataaaattcacaaaaattaaataataatgaacaaaaattagggtataataaaaagaacct
tagattgtagttatggatattgtgataattcagatcatattaatgttgacgtctttggta
acaagccatgaaaagatacacatggtagatatgtatttcaagattattcaatgaatatcg
aattataggaggagatatgtatgaaaagattagttacagggttactagcattatcattat
ttttagctgcatgtggtcaagatagtgaccaacaaaaagacggtaataaagaaaaagatg
ataaagcgaaaactgaacaacaagataaaaaaacaaatgattcatctaaagataagaaag
ataataaagatgatagtaaagacgtaaacaaagataataaagataatagtgcaaacgata
accagcaacaatctaattcaaatgcaacaaacaatgaccaaaaccaaacaaataataacc
aatcaagtaataaccaagcgaataataatcaaaaatcaagttacgttgcaccatattatg
gacaaaatgccgcgccggttgcacgtcaaatttatccgtttaatggaaataaaaatcaag
ctttacagcaattgccaaatttccaaacagctttaaatgcggctaataatgaagcaaata
aatttggtagtaataataaagtgtataatgattattctattgaagaacataatggcaact
ataagtatgtgtttagttttaaagacccaaatgcaaatggaaaatattcaattgtaacgg
ttgattatactggacaagcaatggttactgatccaaactaccaacaataatgttaatata
actatgatgcaagttaaaaaataaaacggtaaactctataatatgaattagggtttaccg
ttttttgcgtattttaaagtatcaaagtttacgttttatagtacttttaaacctcattca
cagccactgagaaatttaaacactattgattagatgtcatcttagacaatataagttgtg
aaatagattctaatggttgttctttatgttgtatttgtggatatttaatcactggtattg
cctgggaaattaaattattaattaataattgtcggtctgtataccaaatttttgatagat
gacgccaaatatcttcgttaacaccttgagactcaatgtattgactgtgatttggagtgt
ataatgctactgttttgtctatagccatcgcatcaaatattatatttgagtaatcagtga
taacgacatcagacattagaattaagtcttgagcactaagatactttggtgcaacaagcg
cctcttctgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
cmr|NT05SA2387 Staphylococcus aureus NCTC 8325     TpgX protein
cmr|SACOL2365 Staphylococcus aureus subsp. aureus COL     lipoprotein, putative
cmr|SAUSA300_2315 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative lipoprotein
dbj|BAF68542.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.207 Staphylococcus aureus subsp. aureus USA300 FIG   hypothetical protein similar to TpgX
fig|426430.6.peg.2198 Staphylococcus aureus subsp. aureus str. Newman FIG   hypothetical protein similar to TpgX
fig|451515.3.peg.2471 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   hypothetical protein similar to TpgX
fig|451516.9.peg.2460 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   hypothetical protein similar to TpgX
fig|452948.4.peg.586 Staphylococcus aureus 930918-3 FIG   hypothetical protein similar to TpgX
fig|455227.3.peg.842 Staphylococcus aureus D30 FIG   hypothetical protein similar to TpgX
fig|546342.3.peg.388 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   hypothetical protein similar to TpgX
fig|546343.3.peg.2680 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   hypothetical protein similar to TpgX
fig|553567.3.peg.814 Staphylococcus aureus A5948 FIG   hypothetical protein similar to TpgX
fig|553590.4.peg.974 Staphylococcus aureus A9754 FIG   hypothetical protein similar to TpgX
fig|553594.3.peg.325 Staphylococcus aureus A9765 FIG   hypothetical protein similar to TpgX
fig|644279.4.peg.2511 Staphylococcus aureus subsp. aureus 132 FIG   hypothetical protein similar to TpgX
fig|93061.3.peg.2504 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   hypothetical protein similar to TpgX
fig|93061.5.peg.2397 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   hypothetical protein similar to TpgX
fig|93062.19.peg.2310 Staphylococcus aureus subsp. aureus COL FIG   hypothetical protein similar to TpgX
fig|93062.4.peg.2425 Staphylococcus aureus subsp. aureus COL FIG   hypothetical protein similar to TpgX
gb|AAW37192.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22174.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative lipoprotein
gb|ABD31658.1 Staphylococcus aureus subsp. aureus NCTC 8325     lipoprotein, putative
gb|ABX30342.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical lipoprotein
gb|EEV83933.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|122538777 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized lipoprotein SAOUHSC_02650; Flags: Precursor
gi|123484643 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized lipoprotein SAUSA300_2315; Flags: Precursor
gi|150375282 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151222482 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_2270
gi|160369371 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical lipoprotein
gi|161510562 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2351
gi|221137406 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_01976
gi|221142616 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_13407
gi|257861118 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451326 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57285098 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650912 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2365
gi|81693855 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized lipoprotein SACOL2365; Flags: Precursor
gi|87127660 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipoprotein
gi|87161686 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_2315
gi|87203848 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   lipoprotein, putative
gi|88196290 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02650
img|637153123 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888958 Staphylococcus aureus aureus USA300 IMG   putative lipoprotein
img|637895261 Staphylococcus aureus aureus NCTC 8325 IMG   lipoprotein, putative
img|640796701 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641310356 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical lipoprotein
img|641772918 Staphylococcus aureus aureus USA300_TCH959 IMG   putative lipoprotein
kegg|saa:SAUSA300_2315 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL2365 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_2270 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_02650 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2351 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001333304.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_2270
ref|YP_001576221.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2351
ref|YP_187170.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL2365
ref|YP_494950.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_2315
ref|YP_501112.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02650
ref|ZP_03562212.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_01976
ref|ZP_03567109.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_13407
ref|ZP_05699359.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
sp|Q2FEC8 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Uncharacterized lipoprotein SAUSA300_2315; Flags: Precursor
sp|Q2FVQ2 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Uncharacterized lipoprotein SAOUHSC_02650; Flags: Precursor
sp|Q5HDI7 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Uncharacterized lipoprotein SACOL2365; Flags: Precursor
sp|Y2315_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized lipoprotein SAUSA300_2315; Flags: Precursor
sp|Y2365_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized lipoprotein SACOL2365; Flags: Precursor
sp|Y2650_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized lipoprotein SAOUHSC_02650; Flags: Precursor
tr|A6QJL0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z559 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical lipoprotein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search