The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2467: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
Translate Function Assignments



Context on contig NC_009641 from base 2486491 to 2499421 (12931 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2462 2486491 2487864 1374 +       2: 12 2   Sensor histidine kinase colocalized with HrtAB transporter locus|NWMN_2264, protein_id|YP_001333298.1, gi|151222476, geneID|5331379
2463 2488027 2488470 444 + 162         FIG01108427: hypothetical protein locus|NWMN_2265, protein_id|YP_001333299.1, gi|151222477, geneID|5331380
2464 2488467 2488922 456 + -4         FIG01108202: hypothetical protein locus|NWMN_2266, protein_id|YP_001333300.1, gi|151222478, geneID|5331381
2465 2490466 2488988 1479 - 65     3: 19 17 5   Malate:quinone oxidoreductase (EC 1.1.5.4) gene_name|mqo, locus|NWMN_2267, protein_id|YP_001333301.1, gi|151222479, geneID|5331382
2466 2492445 2490847 1599 - 380         L-lactate permease locus|NWMN_2268, protein_id|YP_001333302.1, gi|151222480, geneID|5332161
2467 2492747 2494435 1689 + 301     1: 8   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis locus|NWMN_2269, protein_id|YP_001333303.1, gi|151222481, geneID|5331383
2468 2495217 2494588 630 - 152         hypothetical protein similar to TpgX locus|NWMN_2270, protein_id|YP_001333304.1, gi|151222482, geneID|5331384
2469 2496046 2495531 516 - 313         N1-spermidine/spermine acetyltransferase PaiA locus|NWMN_2271, protein_id|YP_001333305.1, gi|151222483, geneID|5331385
2470 2496237 2497241 1005 + 190     7: 16 10 14 15 13 9 11   Acryloyl-CoA reductase AcuI/YhdH (EC 1.3.1.84) locus|NWMN_2272, protein_id|YP_001333306.1, gi|151222484, geneID|5331386
2471 2497688 2497287 402 - 45         Attachment to host cells and virulence locus|NWMN_2273, protein_id|YP_001333307.1, gi|151222485, geneID|5331387
2472 2498758 2497724 1035 - 35     6: 7 4 18 6 3 1   Thioredoxin reductase (EC 1.8.1.9) locus|NWMN_2274, protein_id|YP_001333308.1, gi|151222486, geneID|5331388
2473 2498885 2498769 117 - 10         hypothetical protein  
2474 2499421 2498990 432 - 104         FIG01108300: hypothetical protein locus|NWMN_2275, protein_id|YP_001333309.1, gi|151222487, geneID|5331389

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Teichoic_and_lipoteichoic_acids_biosynthesis OlgaV Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis


  Protein Sequence

>fig|426430.8.peg.2467 Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
MEVIAMIKQINVSNMQKFESQLMKAQSEGYTHVVPYANEIMIYQSMLDAVQLYPKSIVVD
YTVDGQYKNDCHYFGQSSINIADWAQNNNYYPNLIYAIQQTLDLIHYYSVETIFDLALLT
LLKGDLSIDGHVVFDFKAPIATSASIWETIKTIEDFDMMSQFYLNKMAYIDHHPIPFRNL
FIEDSEQLNSPDNWLYSTKFMLPKWLYKIAKQRADNKQLQNFGLYTKQPNVLKDHIVFIG
DHHQYIGNSKYLFTYFVKHNPMTACYFVTDDRRGPHFISPKSEKADELINSARVVIVEND
IPETLQPNGTLIQLHQGTPIMQLFLDSKEPIKNIETPFYRAKRYNRWLQFDYVIHSADDI
SHFYQTAFPSHQANVLAYGNPKHQYLLQKSNESTTQQQYKKSFKINDQKPVLLYAPIGLV
SAQQLPLSDALFKAYHVVVQGVDEAILPEEALVAPKYLSAQDLILMSDVVITDYSNIIFD
AMAIDKTVALYTPNHSQYIESQGVNEDIWRHLSKIWYTDRQLLINNLISQAIPVIKYPQI
QHKEQPLESISQLILSKMTSNQ

MD5 = 0d1b30f7b6dd97042ca980f4a522420e


  DNA Sequence

>fig|426430.8.peg.2467 Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
atggaagttatagcaatgattaaacagataaatgtttctaatatgcaaaagtttgaatct
caattaatgaaagctcagtctgaaggttatacacatgtcgttccatatgccaatgagata
atgatttatcaatcgatgttagatgcggttcaattatatcctaagtctatcgtggttgat
tatactgtggatggacaatacaaaaatgattgtcactatttcggtcaatcatcgatcaac
attgccgattgggctcaaaacaataattattatcctaacctgatatatgcgattcaacag
actcttgatttaatacattattactctgtagaaacgattttcgatttagctttattgaca
cttctgaaaggtgatttatcaatcgatggtcatgtcgtttttgattttaaagcccctata
gcaacaagtgcttcaatatgggaaactattaaaactattgaagattttgatatgatgtct
cagttttatttgaataaaatggcttatattgatcatcatcctataccttttcgcaacctt
tttatcgaggattcagaacaacttaattcgccagataattggttgtattctaccaagttt
atgctacctaaatggttatataaaatagcaaagcaacgtgctgataacaaacaattacaa
aacttcggcctgtatacgaagcaaccaaacgttttaaaagatcacatcgtttttatcggt
gatcatcatcaatatataggtaattcaaaatatttatttacttacttcgttaaacataat
ccaatgactgcctgttattttgttactgacgatcgtcgcggaccacatttcatatcacct
aagtctgaaaaagctgacgaattgattaacagcgcacgcgtagttatagttgaaaatgat
atacctgaaacgttacaaccaaacggtactttaattcaattacatcaaggcacaccaata
atgcaattatttttagatagtaaagagcctattaaaaatatagaaacacctttttatcgt
gctaaaaggtataatcgctggttgcaattcgattatgttatacattctgctgatgatatt
agccacttttatcaaacggcttttcctagtcaccaagcaaatgtattggcttatggtaat
cctaaacaccaatatttactacaaaagagtaacgaaagtactactcaacaacagtataag
aaatcgtttaaaataaatgatcaaaaaccagttttattatacgcacctattggattagtg
agtgcgcaacaattaccactatcagatgctttattcaaagcctatcatgttgtggttcag
ggtgttgatgaagcgatcttaccagaagaggcgcttgttgcaccaaagtatcttagtgct
caagacttaattctaatgtctgatgtcgttatcactgattactcaaatataatatttgat
gcgatggctatagacaaaacagtagcattatacactccaaatcacagtcaatacattgag
tctcaaggtgttaacgaagatatttggcgtcatctatcaaaaatttggtatacagaccga
caattattaattaataatttaatttcccaggcaataccagtgattaaatatccacaaata
caacataaagaacaaccattagaatctatttcacaacttatattgtctaagatgacatct
aatcaatag


  DNA with Flanking Sequence

>fig|426430.8.peg.2467 Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
ctgcaccagaagcgataccaactggcaatttgaaaaatggtattgcaattagtaatgtta
caacaagtgttgtaatagctgcataaatacctttcattttaaaaacagttaaacatagta
aaaacagtacaatcggtattgctgcaattaaagacgataataataaattatcaaatgggt
taaacgtatttactaacataggctgactcttctttccataaagtagtagtgtaattgctt
cattaaaatcatgctctggctatagcattttgttatcgataacattttacagaacagtga
gattaatgtgatttttttcacaattaaaatataccattttttcagactattaacaatatc
actttcctatttaattgttttatttttcattttaaatctgttcatcaaaatgaattgtac
ttaatgtaatgaagtaacttatactattcatgaattttacataagaccgtgctaaaataa
ggaagatactacgatgaggaatggaagttatagcaatgattaaacagataaatgtttcta
atatgcaaaagtttgaatctcaattaatgaaagctcagtctgaaggttatacacatgtcg
ttccatatgccaatgagataatgatttatcaatcgatgttagatgcggttcaattatatc
ctaagtctatcgtggttgattatactgtggatggacaatacaaaaatgattgtcactatt
tcggtcaatcatcgatcaacattgccgattgggctcaaaacaataattattatcctaacc
tgatatatgcgattcaacagactcttgatttaatacattattactctgtagaaacgattt
tcgatttagctttattgacacttctgaaaggtgatttatcaatcgatggtcatgtcgttt
ttgattttaaagcccctatagcaacaagtgcttcaatatgggaaactattaaaactattg
aagattttgatatgatgtctcagttttatttgaataaaatggcttatattgatcatcatc
ctataccttttcgcaacctttttatcgaggattcagaacaacttaattcgccagataatt
ggttgtattctaccaagtttatgctacctaaatggttatataaaatagcaaagcaacgtg
ctgataacaaacaattacaaaacttcggcctgtatacgaagcaaccaaacgttttaaaag
atcacatcgtttttatcggtgatcatcatcaatatataggtaattcaaaatatttattta
cttacttcgttaaacataatccaatgactgcctgttattttgttactgacgatcgtcgcg
gaccacatttcatatcacctaagtctgaaaaagctgacgaattgattaacagcgcacgcg
tagttatagttgaaaatgatatacctgaaacgttacaaccaaacggtactttaattcaat
tacatcaaggcacaccaataatgcaattatttttagatagtaaagagcctattaaaaata
tagaaacacctttttatcgtgctaaaaggtataatcgctggttgcaattcgattatgtta
tacattctgctgatgatattagccacttttatcaaacggcttttcctagtcaccaagcaa
atgtattggcttatggtaatcctaaacaccaatatttactacaaaagagtaacgaaagta
ctactcaacaacagtataagaaatcgtttaaaataaatgatcaaaaaccagttttattat
acgcacctattggattagtgagtgcgcaacaattaccactatcagatgctttattcaaag
cctatcatgttgtggttcagggtgttgatgaagcgatcttaccagaagaggcgcttgttg
caccaaagtatcttagtgctcaagacttaattctaatgtctgatgtcgttatcactgatt
actcaaatataatatttgatgcgatggctatagacaaaacagtagcattatacactccaa
atcacagtcaatacattgagtctcaaggtgttaacgaagatatttggcgtcatctatcaa
aaatttggtatacagaccgacaattattaattaataatttaatttcccaggcaataccag
tgattaaatatccacaaatacaacataaagaacaaccattagaatctatttcacaactta
tattgtctaagatgacatctaatcaatagtgtttaaatttctcagtggctgtgaatgagg
tttaaaagtactataaaacgtaaactttgatactttaaaatacgcaaaaaacggtaaacc
ctaattcatattatagagtttaccgttttattttttaacttgcatcatagttatattaac
attattgttggtagtttggatcagtaaccattgcttgtccagtataatcaaccgttacaa
ttgaatattttccatttgcatttgggtctttaaaactaaacacatacttatagttgccat
tatgttcttcaatagaataatcattatacactttattattactaccaaatttatttgctt
cattattagccgcatttaaagctgtttggaaatttggcaattgctgtaaagcttgatttt
tatttccattaaacggataaatttgacgtgcaaccggcgcggcattttgtccataatatg
gtgcaacgtaacttgatttttgattattattcgcttggttattacttga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2386 Staphylococcus aureus NCTC 8325     TagF domain protein
fig|426430.6.peg.2197 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|451515.3.peg.2470 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|451516.9.peg.2459 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|452948.4.peg.587 Staphylococcus aureus 930918-3 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|455227.3.peg.843 Staphylococcus aureus D30 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|546342.3.peg.387 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|546343.3.peg.2679 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|553567.3.peg.815 Staphylococcus aureus A5948 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|553590.4.peg.973 Staphylococcus aureus A9754 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|553594.3.peg.324 Staphylococcus aureus A9765 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|644279.4.peg.2510 Staphylococcus aureus subsp. aureus 132 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|93061.5.peg.2396 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
fig|93062.19.peg.2309 Staphylococcus aureus subsp. aureus COL FIG   Putative glycosyl/glycerophosphate transferase in teichoic acid biosynthesis
gb|EEV83934.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|257861119 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451327 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
ref|ZP_05699360.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search