The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.2410: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Sialic acid utilization regulator, RpiR family
Translate Function Assignments



Context on contig NC_009641 from base 2433063 to 2444403 (11341 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2404 2434010 2433063 948 -       1: 5   Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2 locus|NWMN_2211, protein_id|YP_001333245.1, gi|151222423, geneID|5331335
2405 2434940 2434143 798 - 132         Inositol monophosphatase family protein locus|NWMN_2212, protein_id|YP_001333246.1, gi|151222424, geneID|5331336
2406 2435325 2436017 693 + 384         Transcriptional regulator, DeoR family locus|NWMN_2213, protein_id|YP_001333247.1, gi|151222425, geneID|5331337
2407 2436373 2436687 315 + 355         IS1272-like transposase, degenerate locus|NWMN_2214, protein_id|YP_001333248.1, gi|151222426, geneID|5331338
2408 2437401 2436664 738 - -24         Protein of pXO2-46 locus|NWMN_2215, protein_id|YP_001333249.1, gi|151222427, geneID|5331339
2409 2437450 2437779 330 + 48         Hypothetical protein SAV2314 locus|NWMN_2216, protein_id|YP_001333250.1, gi|151222428, geneID|5331340
2410 2438224 2439096 873 + 444     1: 7   Sialic acid utilization regulator, RpiR family locus|NWMN_2217, protein_id|YP_001333251.1, gi|151222429, geneID|5331341
2411 2440862 2439483 1380 - 386     4: 4 1 3 6   Histidine transport protein (permease) locus|NWMN_2218, protein_id|YP_001333252.1, gi|151222430, geneID|5331342
2412 2441142 2441498 357 + 279         Hypothetical protein SAV2317 locus|NWMN_2219, protein_id|YP_001333253.1, gi|151222431, geneID|5331343
2413 2441495 2441680 186 + -4         Hypothetical protein SAV2318  
2414 2441967 2441776 192 - 95         Hypothetical protein SAV2319 locus|NWMN_2220, protein_id|YP_001333254.1, gi|151222432, geneID|5331344
2415 2442613 2441978 636 - 10         Phosphoglycolate phosphatase locus|NWMN_2221, protein_id|YP_001333255.1, gi|151222433, geneID|5331345
2416 2443557 2442688 870 - 74     1: 2   COG0385 sodium-dependent transporter locus|NWMN_2222, protein_id|YP_001333256.1, gi|151222434, geneID|5331346
2417 2443873 2444403 531 + 315         Hypothetical protein SAV2322 locus|NWMN_2223, protein_id|YP_001333257.1, gi|151222435, geneID|5331347

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Sialic_Acid_Metabolism OlgaZ Sialic acid utilization regulator, RpiR family


  Protein Sequence

>fig|426430.8.peg.2410 Sialic acid utilization regulator, RpiR family
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH

MD5 = a6977f80fca9f5906c79a95984df9694


  DNA Sequence

>fig|426430.8.peg.2410 Sialic acid utilization regulator, RpiR family
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgcaaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgctacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa


  DNA with Flanking Sequence

>fig|426430.8.peg.2410 Sialic acid utilization regulator, RpiR family
atttttatcatacagaactatctaacgcattatttgcaattaaatttgcccattaaccta
tttttcataaaatgtcatttaaacaagttatttattaaaattcactttattacataaatt
atacaattaaaaagtttcttcaaattgtaaagatgcattaatcgagttataatcataatg
attaagatggtagatttagtcttatataactacatttactaagatttaaatagatgagta
cataatgtataaattgggaatatacagtatgacttacggtaatatatcaatatattgata
tattatttgcacatgggagtatgctattttttatctatacatcttaaaaaaatttacagt
tttacaattcaatatcattaaacaaacaacatattcagcttatttttcattctcttacgt
tacaagttgtaaataccatcgcgttaaacaacaatagccaacgctaataaaatatattgc
gttaaagtggagtgattaatatgtcaaacgtactaacagaaatagatagtcaatatccat
atatgactaaaaatgaaaaaaagatagctaaatttatactaaattcacctcaaaaggtga
ttaaaatgaggtctcaagacttagcaagcttattagatattagtacatcatcagtcattc
gattcagcaagaaaattactgatggcggttttcacgacttgaaaataaatatatctaaat
atgttcctaaagcatcatcaatttacaatgttgaattaatgaataacgaaagcacagaat
ctttaagaactaaactccatacacgtactacacgcgcacttaatcatgcaaataacgaat
taaatgataaaactattgatcaaatatgtcattgtttaaaacgttctgagacgattttta
tatatggttttggcgcatcttttgtagttgctaccgacttataccaaaagttatcaagaa
taggtcttaatattcaacttgttcaagaaacacatatttttgctacattattagcaactc
acaattcgaacgacagtgttattcttattactaacaatggtacgcaaagtgaaatgcaat
caatggttaaagttattgatgactaccatatacctataattacaattactagtacaaggg
ataatcccgtagcacaggcatcaaatattgttttaacttatgggaaaactgatgaaaatg
agatgcatatgggagcaacaacttcattatttgctcaaatgttcactattgatattttat
attatcgttatgttgcattaaattatcacgcatcattagatttcataacacaatctaaaa
tggctttagataactatcgtaaacatttatcaaatattaactttaaacattaacagtctt
atataaattctttaatcatgtcatataataatttatgcatcattttcaaagcttacatgt
cttttatcttgtataacatacgcatatgaccaatgatttgataaggccattcaatttctt
atattaaaaacaaacgcagttgattaacggattcattccatatatcaattgcgtttgtta
ttttaataatgctattttttattttaaagcccacagtaaaaactaacgataatattgcca
cttataagtttttcacactacaacttcgatttaagctatatttataaaaaaatgcgccta
ctcataacattctttggctatttaactttaataagctagggccaagtttgtcataagata
agcgcacattataatcatactattttgcttttacattatttttattatatctaataaaat
aataaatcgttacaatcgttaagaagatgacaccaataagcactgatattctagtttcaa
cattaaataccat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005529       F:sugar binding
GO:0005975       P:carbohydrate metabolic process
GO:0006355       P:regulation of transcription, DNA-dependent
cmr|NT01SA2326 Staphylococcus aureus N315     transcriptional regulator, rpiR family domain protein
cmr|NT02SA2315 Staphylococcus aureus Mu50     transcription regulator RpiR family
cmr|NT03SA2412 Staphylococcus aureus MW2     transcriptional regulator, RpiR family
cmr|NT05SA2330 Staphylococcus aureus NCTC 8325     phosphosugar-binding transcriptional regulator, RpiR family
cmr|NT08SA2372 Staphylococcus aureus subsp. aureus MRSA252     transcription regulator RpiR family
cmr|NT09SA2219 Staphylococcus aureus subsp. aureus MSSA476     transcription regulator RpiR family
cmr|NT11SA2195 Staphylococcus aureus RF122     phosphosugar-binding transcriptional regulator, RpiR family
cmr|SACOL2308 Staphylococcus aureus subsp. aureus COL     phosphosugar-binding transcriptional regulator, RpiR family
dbj|BAB43407.1 Staphylococcus aureus subsp. aureus N315     SA2108
dbj|BAB58477.1 Staphylococcus aureus subsp. aureus Mu50     similar to transcription regulator RpiR family
dbj|BAB96101.1 Staphylococcus aureus subsp. aureus MW2     MW2236
dbj|BAF68489.1 Staphylococcus aureus subsp. aureus str. Newman     phosphosugar-binding transcriptional regulator RpiR family protein
dbj|BAF79182.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG41381.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative transcription regulator
emb|CAG44019.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative transcription regulator
emb|CAI81881.1 Staphylococcus aureus RF122 EMBL   probable transcriptional regulator
fig|158878.1.peg.2315 Staphylococcus aureus subsp. aureus Mu50 FIG   Sialic acid utilization regulator, RpiR family
fig|158878.14.peg.2395 Staphylococcus aureus subsp. aureus Mu50 FIG   Sialic acid utilization regulator, RpiR family
fig|158879.1.peg.2190 Staphylococcus aureus subsp. aureus N315 FIG   Sialic acid utilization regulator, RpiR family
fig|158879.11.peg.2286 Staphylococcus aureus subsp. aureus N315 FIG   Sialic acid utilization regulator, RpiR family
fig|196620.1.peg.2236 Staphylococcus aureus subsp. aureus MW2 FIG   Sialic acid utilization regulator, RpiR family
fig|196620.5.peg.2310 Staphylococcus aureus subsp. aureus MW2 FIG   Sialic acid utilization regulator, RpiR family
fig|273036.3.peg.2130 Staphylococcus aureus RF122 FIG   Sialic acid utilization regulator, RpiR family
fig|273036.6.peg.2309 Staphylococcus aureus RF122 FIG   Sialic acid utilization regulator, RpiR family
fig|282458.1.peg.2272 Staphylococcus aureus subsp. aureus MRSA252 FIG   Sialic acid utilization regulator, RpiR family
fig|282458.4.peg.2417 Staphylococcus aureus subsp. aureus MRSA252 FIG   Sialic acid utilization regulator, RpiR family
fig|282459.1.peg.2185 Staphylococcus aureus subsp. aureus MSSA476 FIG   Sialic acid utilization regulator, RpiR family
fig|282459.5.peg.2295 Staphylococcus aureus subsp. aureus MSSA476 FIG   Sialic acid utilization regulator, RpiR family
fig|359786.13.peg.2475 Staphylococcus aureus subsp. aureus JH9 FIG   Sialic acid utilization regulator, RpiR family
fig|359786.3.peg.2326 Staphylococcus aureus subsp. aureus JH9 FIG   Sialic acid utilization regulator, RpiR family
fig|359787.11.peg.2437 Staphylococcus aureus subsp. aureus JH1 FIG   Sialic acid utilization regulator, RpiR family
fig|359787.3.peg.2114 Staphylococcus aureus subsp. aureus JH1 FIG   Sialic acid utilization regulator, RpiR family
fig|418127.4.peg.2124 Staphylococcus aureus subsp. aureus Mu3 FIG   Sialic acid utilization regulator, RpiR family
fig|418127.6.peg.2359 Staphylococcus aureus subsp. aureus Mu3 FIG   Sialic acid utilization regulator, RpiR family
fig|426430.6.peg.2149 Staphylococcus aureus subsp. aureus str. Newman FIG   Sialic acid utilization regulator, RpiR family
fig|450394.6.peg.1814 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Sialic acid utilization regulator, RpiR family
fig|451515.3.peg.2414 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Sialic acid utilization regulator, RpiR family
fig|451516.9.peg.2403 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Sialic acid utilization regulator, RpiR family
fig|452948.4.peg.1246 Staphylococcus aureus 930918-3 FIG   Sialic acid utilization regulator, RpiR family
fig|455227.3.peg.1880 Staphylococcus aureus D30 FIG   Sialic acid utilization regulator, RpiR family
fig|505321.3.peg.98 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Sialic acid utilization regulator, RpiR family
fig|546342.3.peg.1071 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Sialic acid utilization regulator, RpiR family
fig|546343.3.peg.1275 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Sialic acid utilization regulator, RpiR family
fig|548470.3.peg.1032 Staphylococcus aureus subsp. aureus MN8 FIG   Sialic acid utilization regulator, RpiR family
fig|548473.3.peg.279 Staphylococcus aureus subsp. aureus TCH60 FIG   Sialic acid utilization regulator, RpiR family
fig|548474.3.peg.564 Staphylococcus aureus subsp. aureus TCH130 FIG   Sialic acid utilization regulator, RpiR family
fig|548475.3.peg.1855 Staphylococcus aureus subsp. aureus TCH70 FIG   Sialic acid utilization regulator, RpiR family
fig|553565.3.peg.2090 Staphylococcus aureus A5937 FIG   Sialic acid utilization regulator, RpiR family
fig|553567.3.peg.2294 Staphylococcus aureus A5948 FIG   Sialic acid utilization regulator, RpiR family
fig|553568.3.peg.2644 Staphylococcus aureus A6224 FIG   Sialic acid utilization regulator, RpiR family
fig|553571.3.peg.1613 Staphylococcus aureus A6300 FIG   Sialic acid utilization regulator, RpiR family
fig|553573.3.peg.705 Staphylococcus aureus A8115 FIG   Sialic acid utilization regulator, RpiR family
fig|553574.3.peg.1102 Staphylococcus aureus A8117 FIG   Sialic acid utilization regulator, RpiR family
fig|553577.3.peg.141 Staphylococcus aureus A8796 FIG   Sialic acid utilization regulator, RpiR family
fig|553580.3.peg.143 Staphylococcus aureus A8819 FIG   Sialic acid utilization regulator, RpiR family
fig|553581.3.peg.2580 Staphylococcus aureus A9299 FIG   Sialic acid utilization regulator, RpiR family
fig|553588.3.peg.2669 Staphylococcus aureus A9719 FIG   Sialic acid utilization regulator, RpiR family
fig|553590.4.peg.917 Staphylococcus aureus A9754 FIG   Sialic acid utilization regulator, RpiR family
fig|553592.3.peg.1029 Staphylococcus aureus A9763 FIG   Sialic acid utilization regulator, RpiR family
fig|553594.3.peg.2069 Staphylococcus aureus A9765 FIG   Sialic acid utilization regulator, RpiR family
fig|553596.3.peg.1561 Staphylococcus aureus A9781 FIG   Sialic acid utilization regulator, RpiR family
fig|553601.3.peg.543 Staphylococcus aureus A10102 FIG   Sialic acid utilization regulator, RpiR family
fig|585143.3.peg.788 Staphylococcus aureus subsp. aureus 55/2053 FIG   Sialic acid utilization regulator, RpiR family
fig|585144.3.peg.776 Staphylococcus aureus subsp. aureus 58-424 FIG   Sialic acid utilization regulator, RpiR family
fig|585145.3.peg.585 Staphylococcus aureus subsp. aureus 65-1322 FIG   Sialic acid utilization regulator, RpiR family
fig|585146.3.peg.156 Staphylococcus aureus subsp. aureus 68-397 FIG   Sialic acid utilization regulator, RpiR family
fig|585147.3.peg.1869 Staphylococcus aureus subsp. aureus A017934/97 FIG   Sialic acid utilization regulator, RpiR family
fig|585148.3.peg.2094 Staphylococcus aureus subsp. aureus Btn1260 FIG   Sialic acid utilization regulator, RpiR family
fig|585149.6.peg.2491 Staphylococcus aureus subsp. aureus C101 FIG   Sialic acid utilization regulator, RpiR family
fig|585150.3.peg.704 Staphylococcus aureus subsp. aureus C160 FIG   Sialic acid utilization regulator, RpiR family
fig|585151.3.peg.2298 Staphylococcus aureus subsp. aureus C427 FIG   Sialic acid utilization regulator, RpiR family
fig|585152.3.peg.2293 Staphylococcus aureus subsp. aureus D139 FIG   Sialic acid utilization regulator, RpiR family
fig|585153.3.peg.586 Staphylococcus aureus subsp. aureus E1410 FIG   Sialic acid utilization regulator, RpiR family
fig|585154.3.peg.2375 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Sialic acid utilization regulator, RpiR family
fig|585155.3.peg.859 Staphylococcus aureus subsp. aureus H19 FIG   Sialic acid utilization regulator, RpiR family
fig|585156.3.peg.1870 Staphylococcus aureus subsp. aureus M1015 FIG   Sialic acid utilization regulator, RpiR family
fig|585157.3.peg.1985 Staphylococcus aureus subsp. aureus M809 FIG   Sialic acid utilization regulator, RpiR family
fig|585158.3.peg.365 Staphylococcus aureus subsp. aureus M876 FIG   Sialic acid utilization regulator, RpiR family
fig|585159.3.peg.2420 Staphylococcus aureus subsp. aureus M899 FIG   Sialic acid utilization regulator, RpiR family
fig|585160.3.peg.2128 Staphylococcus aureus subsp. aureus WBG10049 FIG   Sialic acid utilization regulator, RpiR family
fig|585161.3.peg.2180 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Sialic acid utilization regulator, RpiR family
fig|585891.3.peg.2391 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Sialic acid utilization regulator, RpiR family
fig|644279.4.peg.2454 Staphylococcus aureus subsp. aureus 132 FIG   Sialic acid utilization regulator, RpiR family
fig|680649.3.peg.1676 Staphylococcus aureus subsp. aureus MR1 FIG   Sialic acid utilization regulator, RpiR family
fig|681288.4.peg.2339 Staphylococcus aureus subsp. aureus ED98 FIG   Sialic acid utilization regulator, RpiR family
fig|703339.3.peg.2301 Staphylococcus aureus 04-02981 FIG   Sialic acid utilization regulator, RpiR family
fig|762962.3.peg.2198 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Sialic acid utilization regulator, RpiR family
fig|93061.3.peg.2443 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sialic acid utilization regulator, RpiR family
fig|93061.5.peg.2338 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sialic acid utilization regulator, RpiR family
fig|93062.19.peg.2252 Staphylococcus aureus subsp. aureus COL FIG   Sialic acid utilization regulator, RpiR family
fig|93062.4.peg.2370 Staphylococcus aureus subsp. aureus COL FIG   Sialic acid utilization regulator, RpiR family
gb|AAW37137.1 Staphylococcus aureus subsp. aureus COL     phosphosugar-binding transcriptional regulator, RpiR family
gb|ABD31600.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50119.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, RpiR family
gb|ABR53207.1 Staphylococcus aureus subsp. aureus JH1     helix-turn-helix protein RpiR
gb|ABX30290.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     RpiR family transcriptional regulator
gb|EEI96466.1 Staphylococcus aureus subsp. aureus MN8     RpiR family transcriptional regulator
gb|EEJ62460.1 Staphylococcus aureus subsp. aureus TCH60     RpiR family transcriptional regulator
gb|EES55890.1 Staphylococcus aureus subsp. aureus TCH70     RpiR family transcriptional regulator
gb|EES94926.1 Staphylococcus aureus subsp. aureus USA300_TCH959     RpiR family transcriptional regulator
gb|EES96496.1 Staphylococcus aureus subsp. aureus TCH130     RpiR family transcriptional regulator
gi|13702115 Staphylococcus aureus subsp. aureus N315 NCBI   SA2108
gi|14248089 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to transcription regulator RpiR family
gi|147741821 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, RpiR family
gi|148268752 Staphylococcus aureus subsp. aureus JH9 NCBI   RpiR family transcriptional regulator
gi|149947271 Staphylococcus aureus subsp. aureus JH1 NCBI   helix-turn-helix protein RpiR
gi|150375229 Staphylococcus aureus subsp. aureus str. Newman NCBI   phosphosugar-binding transcriptional regulator RpiR family protein
gi|150394819 Staphylococcus aureus subsp. aureus JH1 NCBI   helix-turn-helix protein RpiR
gi|151222429 Staphylococcus aureus subsp. aureus str. Newman NCBI   phosphosugar-binding transcriptional regulator RpiR family protein
gi|156722765 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980630 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2299
gi|15925305 Staphylococcus aureus subsp. aureus Mu50 NCBI   RpiR family transcription regulator
gi|15927895 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2108
gi|160369319 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   RpiR family transcriptional regulator
gi|161510510 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator
gi|21205407 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2236
gi|21283965 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2236
gi|221138073 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   transcriptional regulator
gi|221141249 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   transcriptional regulator
gi|227246707 Staphylococcus aureus subsp. aureus MN8 NCBI   RpiR family transcriptional regulator
gi|227556849 Staphylococcus aureus subsp. aureus MN8 NCBI   RpiR family transcriptional regulator
gi|227852662 Staphylococcus aureus subsp. aureus TCH60 NCBI   RpiR family transcriptional regulator
gi|227898909 Staphylococcus aureus subsp. aureus TCH60 NCBI   RpiR family transcriptional regulator
gi|251803233 Staphylococcus aureus subsp. aureus TCH70 NCBI   RpiR family transcriptional regulator
gi|251813254 Staphylococcus aureus subsp. aureus TCH70 NCBI   RpiR family transcriptional regulator
gi|253314656 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   transcriptional regulator
gi|253726197 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   RpiR family transcriptional regulator
gi|253727767 Staphylococcus aureus subsp. aureus TCH130 NCBI   RpiR family transcriptional regulator
gi|253729984 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   RpiR family transcriptional regulator
gi|253734273 Staphylococcus aureus subsp. aureus TCH130 NCBI   RpiR family transcriptional regulator
gi|255007092 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   transcriptional regulator
gi|49242660 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative transcription regulator
gi|49245541 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative transcription regulator
gi|49484531 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative transcription regulator
gi|49487098 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative transcription regulator
gi|57285043 Staphylococcus aureus subsp. aureus COL NCBI   phosphosugar-binding transcriptional regulator, RpiR family
gi|57650857 Staphylococcus aureus subsp. aureus COL NCBI   RpiR family phosphosugar-binding transcriptional regulator
gi|82657439 Staphylococcus aureus RF122 NCBI   probable transcriptional regulator
gi|82751908 Staphylococcus aureus RF122 NCBI   transcriptional regulator
gi|87203790 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196232 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02589
img|637093858 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100872 Staphylococcus aureus aureus Mu50 IMG   similar to transcription regulator RpiR family
img|637153068 Staphylococcus aureus aureus COL IMG   phosphosugar-binding transcriptional regulator, RpiR family
img|637155833 Staphylococcus aureus aureus MRSA252 IMG   putative transcription regulator
img|637158476 Staphylococcus aureus aureus MSSA476 IMG   putative transcription regulator
img|637300053 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637817173 Staphylococcus aureus RF122 IMG   probable transcriptional regulator
img|637895200 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109311 Staphylococcus aureus aureus JH1 IMG   Helix-turn-helix protein RpiR:Sugar isomerase (SIS)
img|640566727 Staphylococcus aureus aureus JH9 IMG   transcriptional regulator, RpiR family
img|640780494 Staphylococcus aureus aureus JH1 IMG   helix-turn-helix protein RpiR
img|640796648 Staphylococcus aureus aureus Newman IMG   phosphosugar-binding transcriptional regulator RpiR family protein
img|640905097 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310304 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   RpiR family transcriptional regulator
kegg|sab:SAB2192 Staphylococcus aureus RF122 KEGG   transcriptional regulator
kegg|sac:SACOL2308 Staphylococcus aureus subsp. aureus COL KEGG   RpiR family phosphosugar-binding transcriptional regulator
kegg|sae:NWMN_2217 Staphylococcus aureus subsp. aureus Newman KEGG   phosphosugar-binding transcriptional regulator RpiR family protein
kegg|sah:SaurJH1_2382 Staphylococcus aureus subsp. aureus JH1 KEGG   helix-turn-helix protein RpiR
kegg|saj:SaurJH9_2339 Staphylococcus aureus subsp. aureus JH9 KEGG   RpiR family transcriptional regulator
kegg|sam:MW2236 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_02589 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR2399   KEGG   putative transcription regulator
kegg|sas:SAS2208   KEGG   putative transcription regulator
kegg|sau:SA2108   KEGG   hypothetical protein
kegg|sav:SAV2315   KEGG   RpiR family transcription regulator
kegg|saw:SAHV_2299 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2298 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transcriptional regulator
ref|NP_372839.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   RpiR family transcription regulator
ref|NP_375428.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2108
ref|NP_647053.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2236
ref|YP_001247695.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   RpiR family transcriptional regulator
ref|YP_001317494.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   helix-turn-helix protein RpiR
ref|YP_001333251.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phosphosugar-binding transcriptional regulator RpiR family protein
ref|YP_001442889.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2299
ref|YP_001576169.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transcriptional regulator
ref|YP_041755.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative transcription regulator
ref|YP_044319.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative transcription regulator
ref|YP_187115.1 Staphylococcus aureus subsp. aureus COL RefSeq   RpiR family phosphosugar-binding transcriptional regulator
ref|YP_417649.1 Staphylococcus aureus RF122 RefSeq   transcriptional regulator
ref|YP_501051.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02589
ref|ZP_03562875.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   transcriptional regulator
ref|ZP_03565742.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   transcriptional regulator
ref|ZP_03986896.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   RpiR family transcriptional regulator
ref|ZP_04016714.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   RpiR family transcriptional regulator
ref|ZP_04827727.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   RpiR family transcriptional regulator
ref|ZP_04837869.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   transcriptional regulator
ref|ZP_04864149.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   RpiR family transcriptional regulator
ref|ZP_04868438.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   RpiR family transcriptional regulator
ref|ZP_05145693.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   transcriptional regulator
tr|A5IV96 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, RpiR family
tr|A6QJF7 Staphylococcus aureus (strain Newman) TrEMBL   Phosphosugar-binding transcriptional regulator RpiR family protein
tr|A6U439 Staphylococcus aureus (strain JH1) TrEMBL   Helix-turn-helix protein RpiR
tr|A7X5R0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z507 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   RpiR family transcriptional regulator
tr|C2G8N1 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   RpiR family transcriptional regulator
tr|C2K456 Staphylococcus aureus subsp. aureus MN8 TrEMBL   RpiR family transcriptional regulator
tr|C5MZK7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   RpiR family transcriptional regulator
tr|C5Q2R9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   RpiR family transcriptional regulator
tr|C5QG11 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   RpiR family transcriptional regulator
tr|Q2FVV2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YYX3 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Probable transcriptional regulator
tr|Q5HDP2 Staphylococcus aureus (strain COL) TrEMBL   Phosphosugar-binding transcriptional regulator, RpiR family
tr|Q6G705 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative transcription regulator
tr|Q6GEB8 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative transcription regulator
tr|Q7A053 Staphylococcus aureus (strain MW2) TrEMBL   MW2236 protein
tr|Q7A408 Staphylococcus aureus (strain N315) TrEMBL   SA2108 protein
tr|Q99RV8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to transcription regulator RpiR family


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search