The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|426430.8.peg.2362: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
Translate Function Assignments


Context on contig NC_009641 from base 2390059 to 2401407 (11349 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
2353 2390823 2390059 765 -           Hypothetical protein SAV2264 locus|NWMN_2164, protein_id|YP_001333198.1, gi|151222376, geneID|5331912
2354 2390985 2391425 441 + 161     1: 3   Transcriptional regulator, MarR family locus|NWMN_2165, protein_id|YP_001333199.1, gi|151222377, geneID|5331312
2355 2391418 2392629 1212 + -8       dlit(9869592) Major facilitator family transporter locus|NWMN_2166, protein_id|YP_001333200.1, gi|151222378, geneID|5331313
2356 2393081 2392731 351 - 101       dlit(15292128) Transcriptional regulator SarV (Staphylococcal accessory regulator V) gene_name|sarV, locus|NWMN_2167, protein_id|YP_001333201.1, gi|151222379, geneID|5331314
2357 2393513 2393346 168 - 264         hypothetical protein  
2358 2393668 2393549 120 - 35         FIG01108563: hypothetical protein  
2359 2394794 2393772 1023 - 103 19 1: 1 dlit(26575208)
dlit(25941396)		 GTP 3',8-cyclase (EC 4.1.99.22) ## MoaA gene_name|moaA, locus|NWMN_2168, protein_id|YP_001333202.1, gi|151222380, geneID|5332439
2360 2395413 2394814 600 - 19 4 2: 2 1   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77) gene_name|mobA, locus|NWMN_2169, protein_id|YP_001333203.1, gi|151222381, geneID|5332149
2361 2395653 2395420 234 - 6     2: 2 1   Molybdopterin synthase sulfur carrier subunit ## MoaD gene_name|moaD, locus|NWMN_2170, protein_id|YP_001333204.1, gi|151222382, geneID|5332154
2362 2396105 2395659 447 - 5   2: 2 1   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12) gene_name|moaE, locus|NWMN_2171, protein_id|YP_001333205.1, gi|151222383, geneID|5332152
2363 2396604 2396119 486 - 13 5 2: 2 1   Molybdopterin-guanine dinucleotide biosynthesis protein MobB gene_name|mobB, locus|NWMN_2172, protein_id|YP_001333206.1, gi|151222384, geneID|5332153
2364 2397860 2396601 1260 - -4 9 2: 2 1   Molybdopterin biosynthesis protein MoeA gene_name|moeA, locus|NWMN_2173, protein_id|YP_001333207.1, gi|151222385, geneID|5332155
2365 2397923 2398417 495 + 62 19 2: 2 1   Molybdenum cofactor biosynthesis protein MoaC gene_name|moaC, locus|NWMN_2174, protein_id|YP_001333208.1, gi|151222386, geneID|5332159
2366 2398925 2398419 507 - 1 17 2: 2 1   Molybdenum cofactor biosynthesis protein MoaB gene_name|moaB, locus|NWMN_2175, protein_id|YP_001333209.1, gi|151222387, geneID|5332151
2367 2399960 2398956 1005 - 30 5 2: 2 1   Molybdopterin biosynthesis protein MoeB gene_name|moeB, locus|NWMN_2176, protein_id|YP_001333210.1, gi|151222388, geneID|5332150
2368 2400735 2400130 606 - 169     2: 2 1   Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1) gene_name|modC, locus|NWMN_2177, protein_id|YP_001333211.1, gi|151222389, geneID|5332160
2369 2401407 2400736 672 - 0 8 2: 2 1   Molybdenum ABC transporter (EC 7.3.2.5), permease protein ModB gene_name|modB, locus|NWMN_2178, protein_id|YP_001333212.1, gi|151222390, geneID|5332158

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Molybdenum_cofactor_biosynthesis VeronikaV Molybdenum cofactor biosynthesis protein MoaE
Molybdenum_cofactor_biosynthesis_ADH ADHanson Molybdenum cofactor biosynthesis protein MoaE


  Protein Sequence

>fig|426430.8.peg.2362 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE

MD5 = c4a76dc88d5c09d0ef2e620cde708fa9


  DNA Sequence

>fig|426430.8.peg.2362 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcgaagagggaggaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.2362 Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
tatgattttacaaattgtaggttacaaaaagtctggtaagacaacattgatgaggcatat
tgtctctttcttaaagtcacatggttatacagttgctactattaaacatcatgggcatgg
taaggaagatattcaattacaggattcagacgtcgatcacatgaagcattttgaagcggg
ggcagatcaaagtattgtacaaggttttcaatatcagcaaactgtaacacgtgtagataa
tcaaaatcttactcaaattattgaaaaatctgttacaattgacaccaatatcgtattagt
tgaaggctttaaaaatgctgattttgaaaaagtcgtagtctatcgaaatgaagaagagtt
gcaagtattacaacaattgtcgaatgtttgttatagcattaatgtaagggagcatgaaga
ttttacagcatttgagcaatggttattaaataaaattaaaaatgattgtgatacacaatt
aacatagaggattgaaatgaatgaaacaatttgaaatcgtgacagaaccgatacaaacag
aacaatatcgtgaattcactataaatgaatatcaaggtgcagtagttgtttttaccggtc
atgttcgcgaatggactaaaggcgtcaaaacggaatatttagaatatgaagcgtatattc
caatggctgaaaagaaattggcacaaattggagatgaaataaatgaaaaatggcctggaa
cgataacgagtattgttcatagaatagggccattacaaatttcagatatcgctgtattaa
ttgcggtttcttcaccgcatcgtaaagatgcctatcgagcaaatgaatatgcaattgagc
gtataaaagaaattgttccgatttggaaaaaagaaatttgggaagatggttcaaaatggc
aagggcatcaaaaagggaattatgaagaagcgaagagggaggaataagagagatgaaggt
actttacttcgcagaaattaaagatatattacaaaaagcacaggaagatattgtgcttga
acaagcattgactgtacaacaatttgaagatttattgtttgaacgttatccgcaaatcaa
taataaaaagtttcaagttgctgtaaatgaggaatttgtacaaaaatcggatttcattca
acctaatgatactgttgcattaattccaccggttagtggaggttaagggagcatgaaagc
aataattcttgcaggtggtcattcagtgcgatttggtaagcccaaagcttttgcggaagt
gaacggtgagaccttttatagtagagtaattaagacattagaatcaacaaatatgttcaa
tgaaattattattagtacaaatgcgcaattggcaacgcaatttaaatatccaaatgttgt
tatagatgatgagaatcataatgataaaggtccattagcaggaatttatacaatcatgaa
gcaacat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006777       P:Mo-molybdopterin cofactor biosynthetic process
cmr|NT03SA2365 Staphylococcus aureus MW2     molybdenum cofactor biosynthesis protein E
cmr|NT05SA2286 Staphylococcus aureus NCTC 8325     molybdopterin converting factor, subunit 2
cmr|NT08SA2330 Staphylococcus aureus subsp. aureus MRSA252     Molybdopterin converting factor subunit 2 (MPT synthase subunit 2)(Molybdopterin synthase subunit 2) (Molybdenum cofactor biosynthesisprotein E) (Molybdopterin converting factor large subunit)
cmr|NT09SA2176 Staphylococcus aureus subsp. aureus MSSA476     Molybdopterin converting factor subunit 2 (MPT synthase subunit 2)(Molybdopterin synthase subunit 2) (Molybdenum cofactor biosynthesisprotein E) (Molybdopterin converting factor large subunit)
cmr|SACOL2264 Staphylococcus aureus subsp. aureus COL     molybdenum cofactor biosynthesis protein E
cmr|SAUSA300_2222 Staphylococcus aureus subsp. aureus USA300-FPR3757     molybdopterin converting factor, subunit 2
dbj|BAB96054.1 Staphylococcus aureus subsp. aureus MW2     molybdopterin converting factor moa
dbj|BAF68443.1 Staphylococcus aureus subsp. aureus str. Newman     molybdopterin synthase large subunit
emb|CAG41336.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative molybdopterin-synthase large subunit
emb|CAG43972.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative molybdopterin-synthase large subunit
fig|196620.1.peg.2189 Staphylococcus aureus subsp. aureus MW2 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|196620.5.peg.2261 Staphylococcus aureus subsp. aureus MW2 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282458.1.peg.2227 Staphylococcus aureus subsp. aureus MRSA252 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282458.4.peg.2368 Staphylococcus aureus subsp. aureus MRSA252 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282459.1.peg.2139 Staphylococcus aureus subsp. aureus MSSA476 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|282459.5.peg.2246 Staphylococcus aureus subsp. aureus MSSA476 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|367830.3.peg.1963 Staphylococcus aureus subsp. aureus USA300 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|426430.6.peg.2108 Staphylococcus aureus subsp. aureus str. Newman FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|450394.6.peg.1481 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|451515.3.peg.2367 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|451516.9.peg.2356 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|452948.4.peg.1415 Staphylococcus aureus 930918-3 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|455227.3.peg.492 Staphylococcus aureus D30 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|546342.3.peg.142 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|546343.3.peg.206 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548470.3.peg.1082 Staphylococcus aureus subsp. aureus MN8 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548473.3.peg.328 Staphylococcus aureus subsp. aureus TCH60 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548474.3.peg.611 Staphylococcus aureus subsp. aureus TCH130 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|548475.3.peg.1902 Staphylococcus aureus subsp. aureus TCH70 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553567.3.peg.224 Staphylococcus aureus A5948 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553583.3.peg.234 Staphylococcus aureus A9635 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553590.4.peg.870 Staphylococcus aureus A9754 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|553594.3.peg.1153 Staphylococcus aureus A9765 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585143.3.peg.736 Staphylococcus aureus subsp. aureus 55/2053 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585144.3.peg.721 Staphylococcus aureus subsp. aureus 58-424 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585145.3.peg.531 Staphylococcus aureus subsp. aureus 65-1322 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585146.3.peg.102 Staphylococcus aureus subsp. aureus 68-397 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585147.3.peg.1821 Staphylococcus aureus subsp. aureus A017934/97 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585148.3.peg.2045 Staphylococcus aureus subsp. aureus Btn1260 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585149.6.peg.2440 Staphylococcus aureus subsp. aureus C101 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585150.3.peg.654 Staphylococcus aureus subsp. aureus C160 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585151.3.peg.1980 Staphylococcus aureus subsp. aureus C427 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585152.3.peg.2241 Staphylococcus aureus subsp. aureus D139 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585153.3.peg.533 Staphylococcus aureus subsp. aureus E1410 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585154.3.peg.2326 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585155.3.peg.808 Staphylococcus aureus subsp. aureus H19 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585156.3.peg.1819 Staphylococcus aureus subsp. aureus M1015 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585157.3.peg.1935 Staphylococcus aureus subsp. aureus M809 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585158.3.peg.312 Staphylococcus aureus subsp. aureus M876 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585159.3.peg.2367 Staphylococcus aureus subsp. aureus M899 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585160.3.peg.2078 Staphylococcus aureus subsp. aureus WBG10049 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|585161.3.peg.2098 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|644279.4.peg.2407 Staphylococcus aureus subsp. aureus 132 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|762962.3.peg.2247 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93061.3.peg.2395 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93061.5.peg.2290 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93062.19.peg.2205 Staphylococcus aureus subsp. aureus COL FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
fig|93062.4.peg.2326 Staphylococcus aureus subsp. aureus COL FIG   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12)
gb|AAW37136.1 Staphylococcus aureus subsp. aureus COL     molybdenum cofactor biosynthesis protein E
gb|ABD22367.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     molybdopterin converting factor, subunit 2
gb|ABD31554.1 Staphylococcus aureus subsp. aureus NCTC 8325     molybdopterin converting factor moa, putative
gb|ABX30246.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     molybdopterin synthase large subunit
gb|EEI96514.1 Staphylococcus aureus subsp. aureus MN8     molybdopterin converting factor moa (subunit 2)
gb|EEJ62508.1 Staphylococcus aureus subsp. aureus TCH60     molybdopterin converting factor moa (subunit 2)
gb|EES55869.1 Staphylococcus aureus subsp. aureus TCH70     molybdopterin converting factor moa (subunit 2)
gb|EES95114.1 Staphylococcus aureus subsp. aureus USA300_TCH959     molybdopterin converting factor moa (subunit 2)
gb|EES96464.1 Staphylococcus aureus subsp. aureus TCH130     molybdopterin converting factor moa, subunit 2
gb|EEV04874.1 Staphylococcus aureus subsp. aureus 55/2053     molybdopterin-converting factor subunit 2
gb|EEV07514.1 Staphylococcus aureus subsp. aureus 65-1322     molybdopterin-converting factor subunit 2
gb|EEV10139.1 Staphylococcus aureus subsp. aureus 68-397     molybdopterin-converting factor subunit 2
gb|EEV12729.1 Staphylococcus aureus subsp. aureus E1410     molybdopterin-converting factor subunit 2
gb|EEV15390.1 Staphylococcus aureus subsp. aureus M876     molybdopterin-converting factor subunit 2
gb|EEV71136.1 Staphylococcus aureus A9635     molybdopterin-converting factor subunit 2
gb|EEV84320.1 Staphylococcus aureus A5948     molybdopterin-converting factor subunit 2
gb|EEW44846.1 Staphylococcus aureus 930918-3     molybdopterin converting factor moa (subunit 2)
gb|EEW47948.1 Staphylococcus aureus D30     molybdopterin converting factor moa (subunit 2)
gi|150375183 Staphylococcus aureus subsp. aureus str. Newman NCBI   molybdopterin synthase large subunit
gi|151222383 Staphylococcus aureus subsp. aureus str. Newman NCBI   molybdopterin synthase large subunit
gi|160369275 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   molybdopterin synthase large subunit
gi|161510466 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   molybdopterin synthase large subunit
gi|21205360 Staphylococcus aureus subsp. aureus MW2 NCBI   molybdopterin converting factor moa
gi|21283918 Staphylococcus aureus subsp. aureus MW2 NCBI   molybdopterin converting factor moa (subunit 2)
gi|221137153 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   molybdopterin synthase large subunit
gi|221140201 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   molybdopterin synthase large subunit
gi|227246755 Staphylococcus aureus subsp. aureus MN8 NCBI   molybdopterin converting factor moa (subunit 2)
gi|227556897 Staphylococcus aureus subsp. aureus MN8 NCBI   molybdopterin converting factor moa (subunit 2)
gi|227852710 Staphylococcus aureus subsp. aureus TCH60 NCBI   molybdopterin converting factor moa (subunit 2)
gi|227898957 Staphylococcus aureus subsp. aureus TCH60 NCBI   molybdopterin converting factor moa (subunit 2)
gi|251803212 Staphylococcus aureus subsp. aureus TCH70 NCBI   molybdopterin converting factor moa (subunit 2)
gi|251813302 Staphylococcus aureus subsp. aureus TCH70 NCBI   molybdopterin converting factor moa (subunit 2)
gi|253726385 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   molybdopterin converting factor moa (subunit 2)
gi|253727735 Staphylococcus aureus subsp. aureus TCH130 NCBI   molybdopterin converting factor moa, subunit 2
gi|253729938 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   molybdopterin converting factor moa (subunit 2)
gi|253734319 Staphylococcus aureus subsp. aureus TCH130 NCBI   molybdopterin converting factor moa, subunit 2
gi|257272772 Staphylococcus aureus subsp. aureus 55/2053 NCBI   molybdopterin-converting factor subunit 2
gi|257276063 Staphylococcus aureus subsp. aureus 65-1322 NCBI   molybdopterin-converting factor subunit 2
gi|257279552 Staphylococcus aureus subsp. aureus 68-397 NCBI   molybdopterin-converting factor subunit 2
gi|257282597 Staphylococcus aureus subsp. aureus E1410 NCBI   molybdopterin-converting factor subunit 2
gi|257285274 Staphylococcus aureus subsp. aureus M876 NCBI   molybdopterin-converting factor subunit 2
gi|257423754 Staphylococcus aureus subsp. aureus 55/2053 NCBI   molybdopterin-converting factor subunit 2
gi|257426432 Staphylococcus aureus subsp. aureus 65-1322 NCBI   molybdopterin-converting factor subunit 2
gi|257429071 Staphylococcus aureus subsp. aureus 68-397 NCBI   molybdopterin-converting factor subunit 2
gi|257431718 Staphylococcus aureus subsp. aureus E1410 NCBI   molybdopterin-converting factor subunit 2
gi|257434678 Staphylococcus aureus subsp. aureus M876 NCBI   molybdopterin-converting factor subunit 2
gi|257847127 Staphylococcus aureus A9635 NCBI   molybdopterin-converting factor subunit 2
gi|257861518 Staphylococcus aureus A5948 NCBI   molybdopterin-converting factor subunit 2
gi|258422716 Staphylococcus aureus A9635 NCBI   molybdopterin-converting factor subunit 2
gi|258450735 Staphylococcus aureus A5948 NCBI   molybdopterin-converting factor subunit 2
gi|259159806 Staphylococcus aureus 930918-3 NCBI   molybdopterin converting factor moa (subunit 2)
gi|259163390 Staphylococcus aureus D30 NCBI   molybdopterin converting factor moa (subunit 2)
gi|38604900 organism not parsed/found in ncbi nr NCBI   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
gi|49242615 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative molybdopterin-synthase large subunit
gi|49245495 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative molybdopterin-synthase large subunit
gi|49484486 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative molybdopterin-synthase large subunit
gi|49487052 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative molybdopterin-synthase large subunit
gi|57285042 Staphylococcus aureus subsp. aureus COL NCBI   molybdenum cofactor biosynthesis protein E
gi|57650856 Staphylococcus aureus subsp. aureus COL NCBI   molybdenum cofactor biosynthesis protein E
gi|81648814 organism not parsed/found in ncbi nr NCBI   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
gi|81650566 organism not parsed/found in ncbi nr NCBI   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
gi|81693940 organism not parsed/found in ncbi nr NCBI   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
gi|87127853 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   molybdopterin converting factor, subunit 2
gi|87161879 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   molybdopterin converting factor, subunit 2
gi|87203744 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   molybdopterin converting factor moa, putative
gi|88196186 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   molybdopterin converting factor moa, putative
img|637153024 Staphylococcus aureus aureus COL IMG   molybdenum cofactor biosynthesis protein E
img|637155788 Staphylococcus aureus aureus MRSA252 IMG   putative molybdopterin-synthase large subunit
img|637158430 Staphylococcus aureus aureus MSSA476 IMG   putative molybdopterin-synthase large subunit
img|637300006 Staphylococcus aureus aureus MW2 IMG   molybdopterin converting factor moa (subunit 2)
img|637888865 Staphylococcus aureus aureus USA300 IMG   molybdopterin converting factor, subunit 2
img|637895152 Staphylococcus aureus aureus NCTC 8325 IMG   molybdopterin converting factor moa, putative
img|640796602 Staphylococcus aureus aureus Newman IMG   molybdopterin synthase large subunit
img|641310260 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   molybdopterin synthase large subunit
img|641772934 Staphylococcus aureus aureus USA300_TCH959 IMG   molybdopterin synthase large subunit
kegg|saa:SAUSA300_2222 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   molybdopterin converting factor, subunit 2
kegg|sac:SACOL2264 Staphylococcus aureus subsp. aureus COL KEGG   molybdenum cofactor biosynthesis protein E
kegg|sae:NWMN_2171 Staphylococcus aureus subsp. aureus Newman KEGG   molybdopterin synthase large subunit
kegg|sam:MW2189 Staphylococcus aureus subsp. aureus MW2 KEGG   molybdopterin converting factor moa (subunit 2)
kegg|sao:SAOUHSC_02540 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   molybdopterin converting factor moa, putative
kegg|sar:SAR2355   KEGG   putative molybdopterin-synthase large subunit
kegg|sas:SAS2161   KEGG   putative molybdopterin-synthase large subunit
kegg|sax:USA300HOU_2253 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   molybdopterin synthase large subunit
ref|NP_647006.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   molybdopterin converting factor moa (subunit 2)
ref|YP_001333205.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   molybdopterin synthase large subunit
ref|YP_001576125.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   molybdopterin synthase large subunit
ref|YP_041710.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative molybdopterin-synthase large subunit
ref|YP_044273.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative molybdopterin-synthase large subunit
ref|YP_187071.1 Staphylococcus aureus subsp. aureus COL RefSeq   molybdenum cofactor biosynthesis protein E
ref|YP_494857.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   molybdopterin converting factor, subunit 2
ref|YP_501003.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   molybdopterin converting factor moa, putative
ref|ZP_03561964.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   molybdopterin synthase large subunit
ref|ZP_03564694.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   molybdopterin synthase large subunit
ref|ZP_03986944.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   molybdopterin converting factor moa (subunit 2)
ref|ZP_04016762.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   molybdopterin converting factor moa (subunit 2)
ref|ZP_04827775.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   molybdopterin converting factor moa (subunit 2)
ref|ZP_04864103.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   molybdopterin converting factor moa (subunit 2)
ref|ZP_04868484.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   molybdopterin converting factor moa, subunit 2
ref|ZP_05600183.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05602834.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05605458.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05608081.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05610729.1 Staphylococcus aureus subsp. aureus M876 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05685621.1 Staphylococcus aureus A9635 RefSeq   molybdopterin-converting factor subunit 2
ref|ZP_05698794.1 Staphylococcus aureus A5948 RefSeq   molybdopterin-converting factor subunit 2
sp|MOAE_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
sp|MOAE_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
sp|MOAE_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
sp|MOAE_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Molybdopterin-converting factor subunit 2; AltName: Full=Molybdopterin synthase subunit 2; Short=MPT synthase subunit 2; AltName: Full=Molybdenum cofactor biosynthesis protein E; AltName: Full=Molybdopterin-converting factor large subunit
sp|Q5HDT6 Staphylococcus aureus (strain COL) SwissProt   Molybdopterin-converting factor subunit 2
sp|Q6G751 Staphylococcus aureus (strain MSSA476) SwissProt   Molybdopterin-converting factor subunit 2
sp|Q6GEG3 Staphylococcus aureus (strain MRSA252) SwissProt   Molybdopterin-converting factor subunit 2
sp|Q8NVA3 Staphylococcus aureus (strain MW2) SwissProt   Molybdopterin-converting factor subunit 2
tr|A6QJB1 Staphylococcus aureus (strain Newman) TrEMBL   Molybdopterin synthase large subunit
tr|A8Z369 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Molybdopterin synthase large subunit
tr|C2G8S9 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Molybdopterin converting factor moa (Subunit 2)
tr|C2K4A4 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Molybdopterin converting factor moa (Subunit 2)
tr|C5MZG1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Molybdopterin converting factor moa (Subunit 2)
tr|C5Q2W5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Molybdopterin converting factor moa, subunit 2
tr|C5QG59 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Molybdopterin converting factor moa (Subunit 2)
tr|Q2FEM1 Staphylococcus aureus (strain USA300) TrEMBL   Molybdopterin converting factor, subunit 2
tr|Q2FVY2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Molybdopterin converting factor moa, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
19 fig|426430.8.peg.2359 GTP 3',8-cyclase (EC 4.1.99.22) ## MoaA
4 fig|426430.8.peg.2360 Molybdenum cofactor guanylyltransferase (EC 2.7.7.77)
5 fig|426430.8.peg.2363 Molybdopterin-guanine dinucleotide biosynthesis protein MobB
9 fig|426430.8.peg.2364 Molybdopterin biosynthesis protein MoeA
19 fig|426430.8.peg.2365 Molybdenum cofactor biosynthesis protein MoaC
17 fig|426430.8.peg.2366 Molybdenum cofactor biosynthesis protein MoaB
5 fig|426430.8.peg.2367 Molybdopterin biosynthesis protein MoeB
8 fig|426430.8.peg.2369 Molybdenum ABC transporter (EC 7.3.2.5), permease protein ModB


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search