The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1948: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Phage phi 11 orf22 protein homolog
Translate Function Assignments



Context on contig NC_009641 from base 2004935 to 2015770 (10836 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1936 2006212 2004935 1278 -           Phage terminase, large subunit locus|NWMN_1793, protein_id|YP_001332827.1, gi|151222005, geneID|5331080
1937 2006639 2006199 441 - -14         Phage terminase, small subunit locus|NWMN_1794, protein_id|YP_001332828.1, gi|151222006, geneID|5331081
1938 2007248 2006826 423 - 186         Phage integrase regulator RinA locus|NWMN_1795, protein_id|YP_001332829.1, gi|151222007, geneID|5331082
1939 2007418 2007272 147 - 23         Phage protein ORF120  
1940 2007592 2007419 174 - 0         Transcriptional activator rinB, phage associated  
1941 2007795 2007595 201 - 2         Phage protein  
1942 2007958 2007770 189 - -26         Phage phi 11 orf26a protein homolog  
1943 2008530 2007994 537 - 35     1: 1   Phage dimeric dUTPase (EC 3.6.1.23) locus|NWMN_1796, protein_id|YP_001332830.1, gi|151222008, geneID|5331083
1944 2008771 2008523 249 - -8         Phage phi 11 orf23 protein homolog  
1945 2009048 2008764 285 - -8         Phage protein locus|NWMN_1797, protein_id|YP_001332831.1, gi|151222009, geneID|5331084
1946 2009494 2009045 450 - -4         Phage protein locus|NWMN_1798, protein_id|YP_001332832.1, gi|151222010, geneID|5331085
1947 2010083 2009682 402 - 187         Phage protein locus|NWMN_1799, protein_id|YP_001332833.1, gi|151222011, geneID|5331086
1948 2010340 2010098 243 - 14         Phage phi 11 orf22 protein homolog locus|NWMN_1800, protein_id|YP_001332834.1, gi|151222012, geneID|5331087
1949 2010600 2010346 255 - 5         Phage protein locus|NWMN_1801, protein_id|YP_001332835.1, gi|151222013, geneID|5331088
1950 2010959 2010600 360 - -1         Phage phi 11 orf21 protein homolog locus|NWMN_1802, protein_id|YP_001332836.1, gi|151222014, geneID|5331089
1951 2011145 2010960 186 - 0         Phage phi 11 orf19 protein homolog  
1952 2011552 2011145 408 - -1         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|NWMN_1803, protein_id|YP_001332837.1, gi|151222015, geneID|5331090
1953 2011783 2011562 222 - 9         Phage phi 11 orf17 protein homolog  
1954 2012727 2011948 780 - 164     1: 2   Phage DNA helicase loader locus|NWMN_1804, protein_id|YP_001332838.1, gi|151222016, geneID|5331091
1955 2013507 2012737 771 - 9         Phage DNA replication protein O locus|NWMN_1805, protein_id|YP_001332839.1, gi|151222017, geneID|5331092
1956 2013572 2014429 858 + 64         Phage protein locus|NWMN_1806, protein_id|YP_001332840.1, gi|151222018, geneID|5331093
1957 2015206 2014535 672 - 105         Phage phi 11 orf14 protein homolog locus|NWMN_1807, protein_id|YP_001332841.1, gi|151222019, geneID|5331094
1958 2015770 2015219 552 - 12         Phage ssDNA binding protein locus|NWMN_1808, protein_id|YP_001332842.1, gi|151222020, geneID|5331095

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1948 Phage phi 11 orf22 protein homolog
MTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEEL
GIYIKQHGLEYEEQKQLTLF

MD5 = 468b1f307e192f99e6a37db2d8af1d6d


  DNA Sequence

>fig|426430.8.peg.1948 Phage phi 11 orf22 protein homolog
atgacagataacgcgcgtaaagaatacttaaaccaatttttcggctctaagagatatctg
tatcaggataacgagcgagtggcacatatccatgtagtgaatggcgcttattactttcac
gggcatatcgtaccagattggcaaggtgtgaaaaagacatttgatacagcggaagagctc
ggaatatatataaagcaacatggtttggaatacgaggaacagaagcaactaactttattt
tag


  DNA with Flanking Sequence

>fig|426430.8.peg.1948 Phage phi 11 orf22 protein homolog
gttgttagaagccttaaacgcaccttatggcatgcgcttagctgagtataaagaaatcgt
attatccagaattatgcaacgagagagcaaagaacgtgaaatagctaggcaacgacgtaa
agaggttgaactacgtaagaggaaaccacatttgtttaatgtaccacaaaaacattcacg
tgatccgtactggttcgatgtcacttataaccaaatgttcaagaaatggagtgaagcata
atgagcataatcagtaacagaaaagtagatatgaatgaaacgcaagacaatgttaagcaa
ccagcacattacacatacggcgatattgaaattatagattttattgaacaagtaacggca
cagtatccaccacaattagcatttgcaataggtaatgcaatcaaatacttgtctagagca
ccgttaaagaatggtcatgaggatatggcaaaagcgaagttttatgtagatagagtgttt
gacttgtgggagtaatgaccatgacagataacgcgcgtaaagaatacttaaaccaatttt
tcggctctaagagatatctgtatcaggataacgagcgagtggcacatatccatgtagtga
atggcgcttattactttcacgggcatatcgtaccagattggcaaggtgtgaaaaagacat
ttgatacagcggaagagctcggaatatatataaagcaacatggtttggaatacgaggaac
agaagcaactaactttattttagaggagatggaaacaatgaaaatcaaagttaaaaaaga
aatgctattagacgagttaattaaatgggcgcgagaaaatccggagctatcacaagggaa
aatatttttttcaacaggatttagtgatggattcgttcgttttcatccaaatacaaataa
gtgttcgacgtcaagttttattccaattgatatccccttcatagttgatattgaaaaaga
agtaaccaaagacacggtatttgataagttgtttgaaatgtacgagatggaaggaggagt
ctatgaaaccgtattatatgcaaacactagtataaaagaatgtttatatggtagacgttt
gcctaccaaagcattctatatcttaaacgatgatatgacgatgacgttaatctggaaaga
tggggagttggtagaatgatgcaaacctataaagtaagtctttgtatcaagttcttagcg
tctaaatgtaattataaattaaaaaagcattattttgtgcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF66552.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|320835.3.peg.7 Bacteriophage 53 FIG   Phage phi 11 orf22 protein homolog
fig|387910.2.peg.27 Siphoviridae Staphylococcus aureus phage phiNM4 FIG   Phage phi 11 orf22 protein homolog
fig|426430.8.peg.1099 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf22 protein homolog
fig|426430.8.peg.305 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf22 protein homolog
fig|59506.3.peg.71 Bacteriophage 85 FIG   Phage phi 11 orf22 protein homolog
gb|AAX90878.1 Bacteriophage 53     ORF060
gb|AAX90961.1 Bacteriophage 85     ORF062
gb|ABF73252.1 Staphylococcus aureus phage phiNM4     hypothetical protein
gi|104641944 Staphylococcus aureus phage phiNM4 NCBI   hypothetical protein
gi|150373292 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220492 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0280
gi|62635767 Bacteriophage 53 NCBI   ORF060
gi|62635850 Bacteriophage 85 NCBI   ORF062
gi|66394921 Staphylococcus phage 85 NCBI   ORF062
gi|66395417 Staphylococcus phage 53 NCBI   ORF060
img|638314126 Bacteriophage 53 IMG   ORF060
img|638314209 Bacteriophage 85 IMG   ORF062
img|640794640 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|sae:NWMN_0280 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001331314.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0280
ref|YP_239707.1 Staphylococcus phage 53 RefSeq   ORF060
ref|YP_239790.1 Staphylococcus phage 85 RefSeq   ORF062
tr|A0EX43 Staphylococcus aureus phage phiNM4 TrEMBL   Putative uncharacterized protein
tr|A6QDX0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|Q4ZD86 Staphylococcus phage 85 TrEMBL   ORF062
tr|Q4ZDG9 Staphylococcus phage 53 TrEMBL   ORF060


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search