The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1925: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Phage phi 11 orf40 protein homolog
Translate Function Assignments



Context on contig NC_009641 from base 1990961 to 2003382 (12422 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1921 1992862 1990961 1902 -           Phage phi 11 orf44 protein homolog locus|NWMN_1778, protein_id|YP_001332812.1, gi|151221990, geneID|5331065
1922 1993818 1992871 948 - 8         Phage phi 11 orf43 protein homolog locus|NWMN_1779, protein_id|YP_001332813.1, gi|151221991, geneID|5331066
1923 1997298 1993831 3468 - 12     1: 1   Phage tail, tail length tape-measure protein locus|NWMN_1780, protein_id|YP_001332814.1, gi|151221992, geneID|5331067
1924 1997659 1997315 345 - 16         Phage phi 11 orf41 protein homolog locus|NWMN_1781, protein_id|YP_001332815.1, gi|151221993, geneID|5331068
1925 1998054 1997689 366 - 29         Phage phi 11 orf40 protein homolog locus|NWMN_1782, protein_id|YP_001332816.1, gi|151221994, geneID|5331069
1926 1998697 1998116 582 - 61         Phage major tail tube protein locus|NWMN_1783, protein_id|YP_001332817.1, gi|151221995, geneID|5331070
1927 1999099 1998716 384 - 18         Phage phi 11 orf38 protein homolog locus|NWMN_1784, protein_id|YP_001332818.1, gi|151221996, geneID|5331071
1928 1999458 1999111 348 - 11         Phage phi 11 orf37 protein homolog locus|NWMN_1785, protein_id|YP_001332819.1, gi|151221997, geneID|5331072
1929 2000089 1999757 333 - 298         Phage phi 11 orf36 protein homolog locus|NWMN_1787, protein_id|YP_001332821.1, gi|151221999, geneID|5331074
1930 2000385 2000098 288 - 8         Phage transcriptional terminator locus|NWMN_1788, protein_id|YP_001332822.1, gi|151222000, geneID|5331075
1931 2001381 2000407 975 - 21         Phage major capsid protein locus|NWMN_1789, protein_id|YP_001332823.1, gi|151222001, geneID|5331076
1932 2002009 2001395 615 - 13         Phage capsid and scaffold locus|NWMN_1790, protein_id|YP_001332824.1, gi|151222002, geneID|5331077
1933 2002314 2002144 171 - 134         Phage phi 11 orf57 protein homolog  
1934 2003382 2002387 996 - 72         Phage minor capsid protein locus|NWMN_1791, protein_id|YP_001332825.1, gi|151222003, geneID|5331078

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1925 Phage phi 11 orf40 protein homolog
MNVEINGKSLELSFGFKFLREIDNRLGLKVEQASIGQGVSMLPVGLESGNPVVIGEVLIA
STSHLKKQAITINNIDEALDEIAENIGLEEFGSDILTELGKRPMTRNLVEVVETEEKPAE
A

MD5 = b55c6057af6ed36a2ef5ba38136fd4c3


  DNA Sequence

>fig|426430.8.peg.1925 Phage phi 11 orf40 protein homolog
atgaatgtagaaattaacggaaagtcattagaattaagttttggttttaaatttttaaga
gaaatcgataaccgattaggtttaaaagttgagcaagcttctatcggtcaaggtgtatca
atgttgcctgtaggtttagagagtggaaatcctgttgtgattggcgaagttttaattgca
tctacatctcacttgaaaaaacaagcaattactattaataacattgatgaagcactagat
gaaatcgcagaaaatattggactagaagaatttggttcggatattttaacggagttggga
aagcgacctatgacccgaaacctagtcgaagtagtggaaacggaagagaaaccagcggaa
gcctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1925 Phage phi 11 orf40 protein homolog
gtcttataacactggtggttcagttgaatcaacaatgtctggtactgctaaaatgtttta
tggtgacgattttgcagatgaaattgaagatgcagttgtagatcgcgtattgtatgaggc
ttgggaagttgaaagtagaataccaggcaaaaatggagatgctactaaatttaaagcgaa
atatttccaaggtttccacaataaatttgaattaaaagcagaagctaacggtattgatga
atatgaatatgaatatggagtgaatggtcgtttccaacgtggatttgcaacactacctga
ggctgtaacaaagaaacttaaggcgactggatacagattccatgacactacaaaagcaga
tgcgttaactggcgaagatttaacagcaattccacaacctaaggtagattcatcaacggt
tacaccaggagaggtataaaaatagggcgttaagccctatttattttgtttaaattaatc
atgaatggagattttaagttatgaatgtagaaattaacggaaagtcattagaattaagtt
ttggttttaaatttttaagagaaatcgataaccgattaggtttaaaagttgagcaagctt
ctatcggtcaaggtgtatcaatgttgcctgtaggtttagagagtggaaatcctgttgtga
ttggcgaagttttaattgcatctacatctcacttgaaaaaacaagcaattactattaata
acattgatgaagcactagatgaaatcgcagaaaatattggactagaagaatttggttcgg
atattttaacggagttgggaaagcgacctatgacccgaaacctagtcgaagtagtggaaa
cggaagagaaaccagcggaagcctaataacttacgacagaatcgttataacttgtatgtc
aacacttggtattacagatttgaacgttattgagcaaatgacattaacagaatataacta
tcgaatgtatgcgaaagagtatgaaatgctaacccaagaattcgaacgttacaaacttgc
gtttgctattcgtgatgctgcagctactaaaaatgttgggacagaaaataaacctaaaga
ggaatatgtttttaacaacgcaaacgacgtattgccttatgaagaaaatatccaacggct
taacgaaggtaaagatataagatttagtagcgaacgtgatgaatacgaaccacaaaataa
tgaattctttaaagttatagcagaatttaataagcaatagaaagagaggtgttaatgtga
cggaatataaaattaaagcgactattgaagcaagtgtagctaaattcaaaaagcaaattg
atagtgcggttaaatctgtacaaaaattcaaaagagtagcagatca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT02SA0891 Staphylococcus aureus Mu50     conserved hypothetical protein
dbj|BAB57061.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF68054.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77777.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.899 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage phi 11 orf40 protein homolog
fig|158878.14.peg.926 Staphylococcus aureus subsp. aureus Mu50 FIG   Phage phi 11 orf40 protein homolog
fig|387905.2.peg.50 Siphoviridae Staphylococcus phage phiNM FIG   Phage phi 11 orf40 protein homolog
fig|418127.4.peg.825 Staphylococcus aureus subsp. aureus Mu3 FIG   Phage phi 11 orf40 protein homolog
fig|418127.6.peg.911 Staphylococcus aureus subsp. aureus Mu3 FIG   Phage phi 11 orf40 protein homolog
fig|426430.6.peg.1725 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf40 protein homolog
fig|585891.3.peg.925 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Phage phi 11 orf40 protein homolog
fig|59506.3.peg.14 Bacteriophage 85 FIG   Phage phi 11 orf40 protein homolog
gb|AAX90948.1 Bacteriophage 85     ORF044
gb|ABF73080.1 Staphylococcus aureus phage phiNM1     hypothetical protein
gi|104641666 Staphylococcus aureus phage phiNM1 NCBI   hypothetical protein
gi|118430774 Staphylococcus phage phiNM NCBI   hypothetical protein SAPPV1_gp50
gi|14246668 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|150374794 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221994 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1782
gi|156721360 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979225 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0894
gi|15923889 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0899
gi|255005688 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04445
gi|62635837 Bacteriophage 85 NCBI   ORF044
gi|66394908 Staphylococcus phage 85 NCBI   ORF044
img|637099412 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|638314152 Bacteriophage 85 IMG   ORF044
img|640796199 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903635 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641203605 Staphylococcus aureus phage phiNM provirus IMG   hypothetical protein
kegg|sae:NWMN_1782 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sav:SAV0899   KEGG   hypothetical protein
kegg|saw:SAHV_0894 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371423.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0899
ref|YP_001332816.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1782
ref|YP_001441484.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0894
ref|YP_239733.1 Staphylococcus phage 85 RefSeq   ORF044
ref|YP_873999.1 Staphylococcus phage phiNM RefSeq   hypothetical protein SAPPV1_gp50
ref|ZP_05144289.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04445
tr|A0EWM1 Staphylococcus aureus phage phiNM1 TrEMBL   Putative uncharacterized protein
tr|A6QI72 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A7X095 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q4ZDE3 Staphylococcus phage 85 TrEMBL   ORF044
tr|Q931X3 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search