The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1852: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Bacitracin transport ATP-binding protein bcrA
Translate Function Assignments



Context on contig NC_009641 from base 1902646 to 1914528 (11883 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1846 1903368 1902646 723 -           serine protease gene_name|splB, locus|NWMN_1705, protein_id|YP_001332739.1, gi|151221917, geneID|5332496
1847 1904209 1903493 717 - 124         serine protease gene_name|splA, locus|NWMN_1706, protein_id|YP_001332740.1, gi|151221918, geneID|5332495
1848 1904863 1904645 219 - 435         Hypothetical protein within pathogenicity island SaPIn3  
1849 1905173 1905739 567 + 309         probable beta-lactamase locus|NWMN_1708, protein_id|YP_001332742.1, gi|151221920, geneID|5331012
1850 1906911 1906213 699 - 473         BsaG protein gene_name|bsaG, locus|NWMN_1709, protein_id|YP_001332743.1, gi|151221921, geneID|5331013
1851 1907669 1906908 762 - -4         Lantibiotic ABC transporter permease gene_name|bsaE, locus|NWMN_1710, protein_id|YP_001332744.1, gi|151221922, geneID|5331788
1852 1908358 1907666 693 - -4         Bacitracin transport ATP-binding protein bcrA gene_name|bsaF, locus|NWMN_1711, protein_id|YP_001332745.1, gi|151221923, geneID|5331786
1853 1909754 1908381 1374 - 22         Epidermin leader peptide processing serine protease epiP precursor (EC 3.4.21.-) gene_name|bsaP, locus|NWMN_1712, protein_id|YP_001332746.1, gi|151221924, geneID|5331787
1854 1910282 1909764 519 - 9     7: 2 7 3 5 1 4 6   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36) gene_name|bsaD, locus|NWMN_1713, protein_id|YP_001332747.1, gi|151221925, geneID|5331789
1855 1911542 1910298 1245 - 15         Lanthionine biosynthesis cyclase LanC gene_name|bsaC, locus|NWMN_1714, protein_id|YP_001332748.1, gi|151221926, geneID|5331785
1856 1914528 1911535 2994 - -8         Lanthionine biosynthesis protein LanB gene_name|bsaB, locus|NWMN_1715, protein_id|YP_001332749.1, gi|151221927, geneID|5331784

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1852 Bacitracin transport ATP-binding protein bcrA
MAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSGEI
KLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLNVD
KKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGTSI
IISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK

MD5 = 44790a5bb8069b7cde7dfc49b7f48207


  DNA Sequence

>fig|426430.8.peg.1852 Bacitracin transport ATP-binding protein bcrA
atggcaaaattagttactgaaaacatttcgaagcggtttaaaaatcaagatgtattaaag
catattaatatcactttagaaaataacgaagtttatggattacttggtattaatggagcc
ggtaaaacgacacttatgaaaattatatgtggcatacttcaacaagattcaggggaaatt
aaattagataatagaccaatgacacgaaatgatttgcacaaagttggttcgcttattgaa
acacctgcgacatataatcatttaagtgcacaagataatttgaaaattgtgtgtttaaat
gaaagcgttgatttcagcgaaattaatagtgttttaagcttagtcaatttaaatgtcgat
aaaaagaaaaaggttaaggacttttctttaggtatgaaacaaagacttggaattgcaatg
gcattaattaaaaagccagaaattttagtattagacgaaccatctaatggtttagaccca
tatggaatccaagaacttagagaacttctaaaattattaacagaacaaggtactagtatt
attatttcaagtcacattttatctgaaatccaagttttagcagatcatatcggtattatt
catgagggtgagctaaaatatcagcaaagaaataacaaagatgaaaacttagaagagata
ttcttcaaaataacgaaaggtgattacaaatga


  DNA with Flanking Sequence

>fig|426430.8.peg.1852 Bacitracin transport ATP-binding protein bcrA
gaaactaaaattacagcgtgaatatcaaggtaatggcgaagtgaaagatgttcctgcatc
tatggacaatgtcgttacagtaggatctacagatcaaaagagtaatctatctgagttttc
caattttggtatgaattatacagatattgctgcgcccggaggatcatttgcttatttaaa
tcaattcggtgtggataaatggatgaatgaagggtatatgcataaggagaacattttaac
tactgccaataacggaagatatatttatcaagctggaacttcattagccacacctaaagt
ttcgggagcactagctttaatcattgataaatatcatcttgaaaaacatccagataaagc
gattgaattgttatatcagcatgggacatctaagaataataaaccatttagtagatatgg
gcatggtgagcttgatgtgtataaagcattaaatgtagcaaatcaaaaagcaagttaata
aatcaaaggagtttttgattatggcaaaattagttactgaaaacatttcgaagcggttta
aaaatcaagatgtattaaagcatattaatatcactttagaaaataacgaagtttatggat
tacttggtattaatggagccggtaaaacgacacttatgaaaattatatgtggcatacttc
aacaagattcaggggaaattaaattagataatagaccaatgacacgaaatgatttgcaca
aagttggttcgcttattgaaacacctgcgacatataatcatttaagtgcacaagataatt
tgaaaattgtgtgtttaaatgaaagcgttgatttcagcgaaattaatagtgttttaagct
tagtcaatttaaatgtcgataaaaagaaaaaggttaaggacttttctttaggtatgaaac
aaagacttggaattgcaatggcattaattaaaaagccagaaattttagtattagacgaac
catctaatggtttagacccatatggaatccaagaacttagagaacttctaaaattattaa
cagaacaaggtactagtattattatttcaagtcacattttatctgaaatccaagttttag
cagatcatatcggtattattcatgagggtgagctaaaatatcagcaaagaaataacaaag
atgaaaacttagaagagatattcttcaaaataacgaaaggtgattacaaatgatacattt
aaagatagaaggtatcaaatttaaaaattctttcagtatgtatgttttattaataagtcc
gctggtatttctttgttttgctattttcacagtcttattcgccaaaagtaatacgggaac
agcgaatagtgtgtcaccatatataactttactatttaatatttggccaattgctttcat
cccgattgtattatgtatggcttgtaattcgttatttaaaattgaaatgagaaataaatc
atttaattattacttaagtaataattggtcgattacaaaagaaataagagcaaagatttt
cattttatcaatagcatttttggtacattgctttttagtatttattattgcttatatagg
tgacctaattattaatccacatccggttaatgctatgttgttattggtgacaatattgtt
gatgtatgtagtatctctaccattgataccgctcaactttttattaactcgatactttgg
tgtgttcgtatca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0016887       F:ATPase activity
cmr|NT03SA1908 Staphylococcus aureus MW2     epidermin immunity protein F
cmr|NT05SA1730 Staphylococcus aureus NCTC 8325     GdmF
cmr|NT09SA1725 Staphylococcus aureus subsp. aureus MSSA476     GdmF
cmr|SACOL1873 Staphylococcus aureus subsp. aureus COL     epidermin immunity protein F
cmr|SAUSA300_1762 Staphylococcus aureus subsp. aureus USA300-FPR3757     lantibiotic epidermin immunity protein F
dbj|BAB95625.1 Staphylococcus aureus subsp. aureus MW2     bsaF
emb|CAG43545.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative lantibiotic transport ATP-binding protein
fig|196620.1.peg.1760 Staphylococcus aureus subsp. aureus MW2 FIG   Bacitracin transport ATP-binding protein bcrA
fig|196620.5.peg.1829 Staphylococcus aureus subsp. aureus MW2 FIG   Bacitracin transport ATP-binding protein bcrA
fig|282459.1.peg.1724 Staphylococcus aureus subsp. aureus MSSA476 FIG   Bacitracin transport ATP-binding protein bcrA
fig|282459.5.peg.1810 Staphylococcus aureus subsp. aureus MSSA476 FIG   Bacitracin transport ATP-binding protein bcrA
fig|367830.3.peg.1405 Staphylococcus aureus subsp. aureus USA300 FIG   Bacitracin transport ATP-binding protein bcrA
fig|426430.6.peg.1657 Staphylococcus aureus subsp. aureus str. Newman FIG   Bacitracin transport ATP-binding protein bcrA
fig|451515.3.peg.1921 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Bacitracin transport ATP-binding protein bcrA
fig|451516.9.peg.1910 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Bacitracin transport ATP-binding protein bcrA
fig|452948.4.peg.2348 Staphylococcus aureus 930918-3 FIG   Bacitracin transport ATP-binding protein bcrA
fig|455227.3.peg.2418 Staphylococcus aureus D30 FIG   Bacitracin transport ATP-binding protein bcrA
fig|548475.3.peg.804 Staphylococcus aureus subsp. aureus TCH70 FIG   Bacitracin transport ATP-binding protein bcrA
fig|553567.3.peg.2188 Staphylococcus aureus A5948 FIG   Bacitracin transport ATP-binding protein bcrA
fig|553590.4.peg.2301 Staphylococcus aureus A9754 FIG   Bacitracin transport ATP-binding protein bcrA
fig|553594.3.peg.1753 Staphylococcus aureus A9765 FIG   Bacitracin transport ATP-binding protein bcrA
fig|644279.4.peg.1967 Staphylococcus aureus subsp. aureus 132 FIG   Bacitracin transport ATP-binding protein bcrA
fig|762962.3.peg.44 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Bacitracin transport ATP-binding protein bcrA
fig|93061.3.peg.1839 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Bacitracin transport ATP-binding protein bcrA
fig|93061.5.peg.1772 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Bacitracin transport ATP-binding protein bcrA
fig|93062.19.peg.1831 Staphylococcus aureus subsp. aureus COL FIG   Bacitracin transport ATP-binding protein bcrA
fig|93062.4.peg.534 Staphylococcus aureus subsp. aureus COL FIG   Bacitracin transport ATP-binding protein bcrA
gb|AAW36888.1 Staphylococcus aureus subsp. aureus COL     epidermin immunity protein F
gb|ABD20787.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     lantibiotic epidermin immunity protein F
gb|ABD31009.1 Staphylococcus aureus subsp. aureus NCTC 8325     ABC transporter domain protein
gb|ABX29813.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     epidermin ABC superfamily ATP binding cassette transporter, ABC protein
gb|EES54291.1 Staphylococcus aureus subsp. aureus TCH70     lantibiotic epidermin biosynthesis protein
gb|EEV82514.1 Staphylococcus aureus A5948     epidermin immunity protein F
gb|EEW44133.1 Staphylococcus aureus 930918-3     epidermin immunity protein F
gb|EEW46226.1 Staphylococcus aureus D30     epidermin immunity protein F
gi|160368842 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   epidermin ABC superfamily ATP binding cassette transporter, ABC protein
gi|161510033 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   epidermin ABC transporter ATP-binding protein
gi|21204930 Staphylococcus aureus subsp. aureus MW2 NCBI   bsaF
gi|21283489 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1760
gi|251801634 Staphylococcus aureus subsp. aureus TCH70 NCBI   lantibiotic epidermin biosynthesis protein
gi|251814810 Staphylococcus aureus subsp. aureus TCH70 NCBI   lantibiotic epidermin biosynthesis protein
gi|257859665 Staphylococcus aureus A5948 NCBI   epidermin immunity protein F
gi|258452690 Staphylococcus aureus A5948 NCBI   epidermin immunity protein F
gi|259159064 Staphylococcus aureus 930918-3 NCBI   epidermin immunity protein F
gi|259161632 Staphylococcus aureus D30 NCBI   epidermin immunity protein F
gi|49245079 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative lantibiotic transport ATP-binding protein
gi|49486636 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative lantibiotic transport ATP-binding protein
gi|57284794 Staphylococcus aureus subsp. aureus COL NCBI   epidermin immunity protein F
gi|57650608 Staphylococcus aureus subsp. aureus COL NCBI   epidermin immunity protein F
gi|87126273 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   lantibiotic epidermin immunity protein F
gi|87160299 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   lantibiotic epidermin immunity protein F
gi|87203199 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ABC transporter domain protein
gi|88195641 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ABC transporter
img|637152601 Staphylococcus aureus aureus COL IMG   epidermin immunity protein F
img|637157961 Staphylococcus aureus aureus MSSA476 IMG   putative lantibiotic transport ATP-binding protein
img|637299524 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888408 Staphylococcus aureus aureus USA300 IMG   lantibiotic epidermin immunity protein F
img|637894541 Staphylococcus aureus aureus NCTC 8325 IMG   ABC transporter domain protein
img|641309768 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   epidermin ABC superfamily ATP binding cassette transporter, ABC protein
img|641772408 Staphylococcus aureus aureus USA300_TCH959 IMG   epidermin ABC superfamily ATP binding cassette transporter, ABC protein
kegg|saa:SAUSA300_1762 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   lantibiotic epidermin immunity protein F
kegg|sac:SACOL1873 Staphylococcus aureus subsp. aureus COL KEGG   epidermin immunity protein F
kegg|sam:MW1760 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01948 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   ABC transporter
kegg|sas:SAS1741   KEGG   putative lantibiotic transport ATP-binding protein
kegg|sax:USA300HOU_1810 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   epidermin ABC transporter ATP-binding protein
ref|NP_646577.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1760
ref|YP_001575692.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   epidermin ABC transporter ATP-binding protein
ref|YP_043857.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative lantibiotic transport ATP-binding protein
ref|YP_186701.1 Staphylococcus aureus subsp. aureus COL RefSeq   epidermin immunity protein F
ref|YP_494453.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   lantibiotic epidermin immunity protein F
ref|YP_500447.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   ABC transporter
ref|ZP_04829283.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   lantibiotic epidermin biosynthesis protein
ref|ZP_05700689.1 Staphylococcus aureus A5948 RefSeq   epidermin immunity protein F
tr|A8Z4P3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Epidermin ABC superfamily ATP binding cassette transporter, ABC protein
tr|C5QKG7 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Lantibiotic epidermin biosynthesis protein
tr|Q2FFS5 Staphylococcus aureus (strain USA300) TrEMBL   Lantibiotic epidermin immunity protein F
tr|Q2FXB7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   ABC transporter domain protein
tr|Q5HEV6 Staphylococcus aureus (strain COL) TrEMBL   Epidermin immunity protein F
tr|Q6G8B6 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative lantibiotic transport ATP-binding protein
tr|Q8NVX0 Staphylococcus aureus (strain MW2) TrEMBL   BsaF protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search