The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.176: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01108215: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 205885 to 217697 (11813 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
173 205885 208134 2250 +       3: 2 5 4   Pyruvate formate-lyase (EC 2.3.1.54) gene_name|pflB, locus|NWMN_0162, protein_id|YP_001331197.1, gi|151220374, geneID|5330023
174 208157 208912 756 + 22     2: 2 5   Pyruvate formate-lyase activating enzyme (EC 1.97.1.4) locus|NWMN_0163, protein_id|YP_001331198.1, gi|151220375, geneID|5332259
175 209248 211011 1764 + 335         Glycerophosphoryl diester phosphodiesterase, periplasmic (EC 3.1.4.46) locus|NWMN_0164, protein_id|YP_001331199.1, gi|151220376, geneID|5330024
176 211519 211175 345 - 163       FIG01108215: hypothetical protein locus|NWMN_0165, protein_id|YP_001331200.1, gi|151220377, geneID|5330025
177 211709 213619 1911 + 189 6 1: 6   Staphylocoagulase gene_name|coa, locus|NWMN_0166, protein_id|YP_001331201.1, gi|151220378, geneID|5330026
178 215406 214222 1185 - 602     5: 8 13 3 1 10   3-ketoacyl-CoA thiolase (EC 2.3.1.16) gene_name|fadA, locus|NWMN_0167, protein_id|YP_001331202.1, gi|151220379, geneID|5331829
179 217697 215436 2262 - 29     11: 16 14 3 11 12 17 1 7 9 4 15   Enoyl-CoA hydratase (EC 4.2.1.17) / Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) gene_name|fadB, locus|NWMN_0168, protein_id|YP_001331203.1, gi|151220380, geneID|5331895

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.176 FIG01108215: hypothetical protein
MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN

MD5 = a8a5567c748910caf07506fb081c9e41


  DNA Sequence

>fig|426430.8.peg.176 FIG01108215: hypothetical protein
atgacaacacaaatgaaaatcaaaacatatttagttgctggtattaaagcggcgctcctt
gatacgactggtattaaattagcaagcaaatctgaaactacatcacatacgtatcaacat
caagcgcttgtagatcaattacatgaattaatagcaaacactgacttaaataaattatcg
tacctaaatttagatgcgtttcaaaaacgcgatattttagctgcgcactatattgcaaaa
tccgctatacgcactaaaaatttggatcaaatgactaaagcgaaacaaagattagaaagt
atttacaattcaatttctaaccctttgcattcacaaaacaattaa


  DNA with Flanking Sequence

>fig|426430.8.peg.176 FIG01108215: hypothetical protein
ttctttctctccaaaagatattgatcttcccttaataccttttccaacaacctatcttta
gcttctttataaatattatctccatattcatatttattagttaatcctatagcataaatt
atatagtcttccaaataatatagagctgaatttaaatatctgctatctattaatgtccca
tttttactcccagcattaacttgtgatttcccactataatcctttgttactatcgcatct
gctttgttatcccatgtaaataagctagatgcaactgctaatgcgcctagcgaaattatt
tgctttttcataattttttaattcctccaaaatgtaattgcccaatctacattaaagaaa
caaaatattaaaagacattaactatatattaactagaataaacaaagcattaactatctt
tttgttatagttaattagctttgcaatatacaatagtgtataatttttttgattaatgta
catcaaaggagtaacaaagcatgacaacacaaatgaaaatcaaaacatatttagttgctg
gtattaaagcggcgctccttgatacgactggtattaaattagcaagcaaatctgaaacta
catcacatacgtatcaacatcaagcgcttgtagatcaattacatgaattaatagcaaaca
ctgacttaaataaattatcgtacctaaatttagatgcgtttcaaaaacgcgatattttag
ctgcgcactatattgcaaaatccgctatacgcactaaaaatttggatcaaatgactaaag
cgaaacaaagattagaaagtatttacaattcaatttctaaccctttgcattcacaaaaca
attaataattcaccaataaatcatgtaagtgtttgtgacgccaaattgccatacaaatac
ttgtcatatgaatataaacgaatgaaacgattgcctatcccatagatggcaacattaaaa
agacctctgaaggtatcatcttgataactttagaggtctttgtttatattattcaaacaa
aattcttatagaacgatcgaagtatgtttcgtctttcttttcttctttaatctgatcagc
taatgctgggtcatctgtgataataccatcaacattggtttgtaagtatttcgttaaatc
ttcttcgccgttaatagtccaagtatagacttctttattttccaagtgcgcttgattaac
aagtcttggcgaataagaaaaatcttcgatgacaaagaaatctaatgatgtttctttaaa
atgaccaaactgcaacggaatgatataaccacacttgagatatggcgcttcttttttcaa
cttagtcatcacatcataatccaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0236 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0223 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT05SA0172 Staphylococcus aureus NCTC 8325     hyothetical protein
cmr|SACOL0208 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_0223 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41443.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB56391.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF66437.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77111.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.229 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108215: hypothetical protein
fig|158878.14.peg.232 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108215: hypothetical protein
fig|158879.1.peg.226 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108215: hypothetical protein
fig|158879.11.peg.232 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108215: hypothetical protein
fig|359786.13.peg.257 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108215: hypothetical protein
fig|359786.3.peg.1068 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108215: hypothetical protein
fig|359787.11.peg.254 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108215: hypothetical protein
fig|359787.3.peg.2025 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108215: hypothetical protein
fig|367830.3.peg.1832 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108215: hypothetical protein
fig|418127.4.peg.207 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108215: hypothetical protein
fig|418127.6.peg.230 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108215: hypothetical protein
fig|426430.6.peg.165 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108215: hypothetical protein
fig|451515.3.peg.283 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108215: hypothetical protein
fig|451516.9.peg.273 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108215: hypothetical protein
fig|452948.4.peg.76 Staphylococcus aureus 930918-3 FIG   FIG01108215: hypothetical protein
fig|455227.3.peg.238 Staphylococcus aureus D30 FIG   FIG01108215: hypothetical protein
fig|505321.3.peg.900 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108215: hypothetical protein
fig|553565.3.peg.2548 Staphylococcus aureus A5937 FIG   FIG01108215: hypothetical protein
fig|553567.3.peg.1150 Staphylococcus aureus A5948 FIG   FIG01108215: hypothetical protein
fig|553568.3.peg.863 Staphylococcus aureus A6224 FIG   FIG01108215: hypothetical protein
fig|553571.3.peg.2132 Staphylococcus aureus A6300 FIG   FIG01108215: hypothetical protein
fig|553573.3.peg.2025 Staphylococcus aureus A8115 FIG   FIG01108215: hypothetical protein
fig|553574.3.peg.734 Staphylococcus aureus A8117 FIG   FIG01108215: hypothetical protein
fig|553577.3.peg.903 Staphylococcus aureus A8796 FIG   FIG01108215: hypothetical protein
fig|553580.3.peg.639 Staphylococcus aureus A8819 FIG   FIG01108215: hypothetical protein
fig|553581.3.peg.2157 Staphylococcus aureus A9299 FIG   FIG01108215: hypothetical protein
fig|553588.3.peg.1542 Staphylococcus aureus A9719 FIG   FIG01108215: hypothetical protein
fig|553590.4.peg.1226 Staphylococcus aureus A9754 FIG   FIG01108215: hypothetical protein
fig|553592.3.peg.922 Staphylococcus aureus A9763 FIG   FIG01108215: hypothetical protein
fig|553594.3.peg.885 Staphylococcus aureus A9765 FIG   FIG01108215: hypothetical protein
fig|553596.3.peg.829 Staphylococcus aureus A9781 FIG   FIG01108215: hypothetical protein
fig|553601.3.peg.94 Staphylococcus aureus A10102 FIG   FIG01108215: hypothetical protein
fig|585891.3.peg.231 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108215: hypothetical protein
fig|644279.4.peg.294 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108215: hypothetical protein
fig|680649.3.peg.245 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108215: hypothetical protein
fig|681288.4.peg.200 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108215: hypothetical protein
fig|703339.3.peg.232 Staphylococcus aureus 04-02981 FIG   FIG01108215: hypothetical protein
fig|93061.3.peg.201 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108215: hypothetical protein
fig|93061.5.peg.178 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108215: hypothetical protein
fig|93062.19.peg.206 Staphylococcus aureus subsp. aureus COL FIG   FIG01108215: hypothetical protein
fig|93062.4.peg.674 Staphylococcus aureus subsp. aureus COL FIG   FIG01108215: hypothetical protein
gb|AAW38766.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0208
gb|ABD21483.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29369.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48020.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0213
gb|ABR51081.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28268.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0237
gb|EEV26271.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65102.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67071.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71845.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74415.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77055.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81067.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83529.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84767.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW46055.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0714
gb|EEW48173.1 Staphylococcus aureus D30     hypothetical protein SAD30_1728
gi|13700144 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14245996 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147739722 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0213
gi|148266653 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0213
gi|149945145 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373177 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392693 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0219
gi|151220377 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0165
gi|156720694 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978559 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0228
gi|15923219 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0229
gi|15925932 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0221
gi|160367297 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0237
gi|161508488 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0237
gi|253315418 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_04547
gi|255005024 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_01115
gi|257787931 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257793959 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840643 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842649 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847849 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850467 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854102 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858179 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860707 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257861994 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408634 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421225 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438973 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444208 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447089 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448548 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451659 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258455782 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259161036 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0714
gi|259163617 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1728
gi|57286672 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0208
gi|57652486 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0208
gi|87126969 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160995 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0223
gi|87201559 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194001 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00191
img|637091823 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098728 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637150990 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886878 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892862 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108429 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640564543 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778289 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640794525 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640902950 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308196 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771938 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0223 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0208 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0165 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0219 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0213 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00191 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA0221   KEGG   hypothetical protein
kegg|sav:SAV0229   KEGG   hypothetical protein
kegg|saw:SAHV_0228 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0237 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_370753.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0229
ref|NP_373465.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0221
ref|YP_001245596.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0213
ref|YP_001315368.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0219
ref|YP_001331200.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0165
ref|YP_001440818.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0228
ref|YP_001574147.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0237
ref|YP_185107.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0208
ref|YP_492937.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0223
ref|YP_498788.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00191
ref|ZP_04838631.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_04547
ref|ZP_05143625.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_01115
ref|ZP_05642938.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680919.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684152.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690064.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692542.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695239.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696661.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699685.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703737.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IP97 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QDK5 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TY13 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WXN0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z0I9 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FK41 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1D4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJF0 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q7A7X3 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0221
tr|Q99WZ4 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|426430.8.peg.177 Staphylocoagulase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search