The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1742: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Cysteine desulfurase (EC 2.8.1.7)
Translate Function Assignments



Context on contig NC_009641 from base 1782338 to 1793464 (11127 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1737 1783540 1782338 1203 -       6: 11 6 12 17 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87     2: 5 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 21 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43 25 2: 20 16   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1   6: 13 9 10 1 19 3   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73 6 2: 8 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243 4 3: 15 4 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 14 7   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-393130.3.peg.794 OlgaV Cysteine desulfurase (EC 2.8.1.7)
CBSS-84588.1.peg.1247 OlgaV Cysteine desulfurase (EC 2.8.1.7)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine desulfurase (EC 2.8.1.7)
Alanine_biosynthesis OlgaZ Cysteine desulfurase (EC 2.8.1.7)
Alr_Ahuja Cysteine desulfurase (EC 2.8.1.7)
DNA/RNA_S_modification Cysteine desulfurase (EC 2.8.1.7)


  Protein Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK

MD5 = f4ca70cddd96a9c0d2cca761b2704e6a


  DNA Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
atgattaatgaaagagaagtgtttattttgatatatctagataatgcggcaacgacgaaa
gcatttgaagaagtgttagatacttatttaaaagtaaatcaatcaatgtattataatccg
aatagtccgcataaagctggtttgcaggcaaatcaattactacaacaagcaaaaacccaa
attaatgcaatgattaattcaaaaacaaattatgatgttgtattcactagtggtgcaact
gaatccaataatcttgctttaaaaggtattgcctatcgtaaatttgatacagcgaaggaa
ataattacatccgtgttagagcatccgtccgtattagaggttgtaagatatttggaagca
cacgaaggatttaaagttaaatatgttgatgtaaagaaagatggcagtattaacttagaa
cacttcaaagaattaatgtcagacaaagtcggtttagtaacatgtatgtatgtaaataat
gtaactggacaaatacagcctattccacaaatggctaaagttataaaaaattatcctaag
gcacattttcatgtagatgcggttcaagcattcggcaaaatttcaatggatctcaataac
atagatagtattagtttaagtggacacaagtttaatggtttaaaaggacaaggcgtctta
cttgtaaatcacattcaaaatgttgaaccaactgtccatggtggtggtcaagaatatggc
gttagaagtggaacagttaatttgccaaatgatattgcaatggttaaagcgatgaagata
gctaatgaaaactttgaagcattgaatgcatttgttactgagttaaataatgacgtccgt
caatttttaaataaatatcatggagtttatattaattcttcaacttcaggttcaccattc
gttttaaatattagttttcctggcgtaaaaggtgaagtattagttaatgctttttcaaaa
tatgacattatgatatctacgacaagtgcttgttcatctaaacgtaataaattaaatgaa
gtattggctgcaatgggattatcagacaaatctattgaaggtagtataagattatcattt
ggggctactacaactaaagaagatatagcgaggtttaaagaaatatttatcatcatttat
gaggaaattaaggagttgctaaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
aaggactatagcaatgttgataagagcttaaatgaagctgaacgattatttaaaaataat
cgctataagcgtgcgattgaaattgcagagcaagctcttgaaagtgttgagccaggtgtt
actaaacatattgaagaagaagttattaagcaatagaaactagtatgtagttatacttaa
ataatatgagcactctgtcaaattggactgatgagtttaataattgaagttagccaacga
tacgttgtctagcttcttttttatatggataaatgaaagggacaataaatataaatagca
attgtttaaagataaacgtaatcaaatgtgttgttttaattaatataagtagtgaaaaaa
gcataatcacacagctgtttaaatagagtgaaatagtctaattcttatttaataagtaga
aataagattattttgcgctataacctttattttttgtcggataatagtataatgcttgag
taaaacaattttaacgattgatgattaatgaaagagaagtgtttattttgatatatctag
ataatgcggcaacgacgaaagcatttgaagaagtgttagatacttatttaaaagtaaatc
aatcaatgtattataatccgaatagtccgcataaagctggtttgcaggcaaatcaattac
tacaacaagcaaaaacccaaattaatgcaatgattaattcaaaaacaaattatgatgttg
tattcactagtggtgcaactgaatccaataatcttgctttaaaaggtattgcctatcgta
aatttgatacagcgaaggaaataattacatccgtgttagagcatccgtccgtattagagg
ttgtaagatatttggaagcacacgaaggatttaaagttaaatatgttgatgtaaagaaag
atggcagtattaacttagaacacttcaaagaattaatgtcagacaaagtcggtttagtaa
catgtatgtatgtaaataatgtaactggacaaatacagcctattccacaaatggctaaag
ttataaaaaattatcctaaggcacattttcatgtagatgcggttcaagcattcggcaaaa
tttcaatggatctcaataacatagatagtattagtttaagtggacacaagtttaatggtt
taaaaggacaaggcgtcttacttgtaaatcacattcaaaatgttgaaccaactgtccatg
gtggtggtcaagaatatggcgttagaagtggaacagttaatttgccaaatgatattgcaa
tggttaaagcgatgaagatagctaatgaaaactttgaagcattgaatgcatttgttactg
agttaaataatgacgtccgtcaatttttaaataaatatcatggagtttatattaattctt
caacttcaggttcaccattcgttttaaatattagttttcctggcgtaaaaggtgaagtat
tagttaatgctttttcaaaatatgacattatgatatctacgacaagtgcttgttcatcta
aacgtaataaattaaatgaagtattggctgcaatgggattatcagacaaatctattgaag
gtagtataagattatcatttggggctactacaactaaagaagatatagcgaggtttaaag
aaatatttatcatcatttatgaggaaattaaggagttgctaaaataatgaagtatgatca
cttgcttgttagatacggggagttaacattaaagggttcaaatagaaagaaatttgtaaa
tcaattaagaaataatgtaaataagtcattaaaaggacttgatgggtttgtcgttaaagg
caaacgagatcgtatgtatattgaacttgaagaccatgcagatataaatgaaataacata
tcgattatcaaaaattttcggtattaaatctattagtccagtattaaaagtagaaaaaac
aatagaggcaataagtgcagcggcaattaaatttgcgcagcaatttgaagaaaacagcac
atttaaaattgatgtgaagcgtgccgataaaaatttcccaatggatacgtatgaattaca
gcgtgaattgggtggtgcagtattgaagcacttcgacaatatttcagtgaatgtcaaacg
tccagatcatgaaattcgagtggaagttagattagatgcaatttatatgtatgaagaagt
tgttccg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1626 Staphylococcus aureus NCTC 8325     aminotransferase, class V
fig|426430.6.peg.1561 Staphylococcus aureus subsp. aureus str. Newman FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|451515.3.peg.1813 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|451516.9.peg.1802 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|455227.3.peg.1058 Staphylococcus aureus D30 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|546342.3.peg.934 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553567.3.peg.380 Staphylococcus aureus A5948 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553590.4.peg.1937 Staphylococcus aureus A9754 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553594.3.peg.1812 Staphylococcus aureus A9765 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|644279.4.peg.1861 Staphylococcus aureus subsp. aureus 132 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|93061.5.peg.1664 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|93062.19.peg.1723 Staphylococcus aureus subsp. aureus COL FIG   Cysteine desulfurase (EC 2.8.1.7)
gb|EEV84233.1 Staphylococcus aureus A5948     aminotransferase class V
gi|257861425 Staphylococcus aureus A5948 NCBI   aminotransferase class V
gi|258450889 Staphylococcus aureus A5948 NCBI   aminotransferase class V
ref|ZP_05698942.1 Staphylococcus aureus A5948 RefSeq   aminotransferase class V


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
25 fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
6 fig|426430.8.peg.1744 Septation ring formation regulator EzrA
4 fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search