The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1742: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Cysteine desulfurase (EC 2.8.1.7)
Translate Function Assignments



Context on contig NC_009641 from base 1782338 to 1793464 (11127 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1737 1783540 1782338 1203 -       6: 9 6 12 15 18 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|NWMN_1605, protein_id|YP_001332639.1, gi|151221817, geneID|5330942
1738 1784575 1783628 948 - 87     2: 5 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|NWMN_1606, protein_id|YP_001332640.1, gi|151221818, geneID|5331711
1739 1785192 1784698 495 - 122     2: 21 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|NWMN_1607, protein_id|YP_001332641.1, gi|151221819, geneID|5330943
1740 1786060 1785290 771 - 97         Putative membrane protein YfcA locus|NWMN_1608, protein_id|YP_001332642.1, gi|151221820, geneID|5330944
1741 1787327 1786104 1224 - 43 25 2: 19 16   tRNA S(4)U 4-thiouridine synthase (former ThiI) gene_name|thiI, locus|NWMN_1609, protein_id|YP_001332643.1, gi|151221821, geneID|5330945
1742 1788493 1787327 1167 - -1   6: 13 11 10 1 20 3   Cysteine desulfurase (EC 2.8.1.7) locus|NWMN_1610, protein_id|YP_001332644.1, gi|151221822, geneID|5332537
1743 1788630 1788764 135 + 136         FIG01108306: hypothetical protein  
1744 1790532 1788838 1695 - 73 6 2: 8 1   Septation ring formation regulator EzrA gene_name|ezrA, locus|NWMN_1611, protein_id|YP_001332645.1, gi|151221823, geneID|5330946
1745 1790669 1791133 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|NWMN_1612, protein_id|YP_001332646.1, gi|151221824, geneID|5331891
1746 1791377 1791979 603 + 243 4 3: 17 4 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|NWMN_1613, protein_id|YP_001332647.1, gi|151221825, geneID|5330947
1747 1792938 1792195 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|NWMN_1614, protein_id|YP_001332648.1, gi|151221826, geneID|5332407
1748 1793018 1793464 447 + 79     2: 14 7   Organic hydroperoxide resistance protein locus|NWMN_1615, protein_id|YP_001332649.1, gi|151221827, geneID|5330948

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-393130.3.peg.794 OlgaV Cysteine desulfurase (EC 2.8.1.7)
CBSS-84588.1.peg.1247 OlgaV Cysteine desulfurase (EC 2.8.1.7)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine desulfurase (EC 2.8.1.7)
Alanine_biosynthesis OlgaZ Cysteine desulfurase (EC 2.8.1.7)
Alr_Ahuja Cysteine desulfurase (EC 2.8.1.7)
DNA/RNA_S_modification Cysteine desulfurase (EC 2.8.1.7)


  Protein Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK

MD5 = f4ca70cddd96a9c0d2cca761b2704e6a


  DNA Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
atgattaatgaaagagaagtgtttattttgatatatctagataatgcggcaacgacgaaa
gcatttgaagaagtgttagatacttatttaaaagtaaatcaatcaatgtattataatccg
aatagtccgcataaagctggtttgcaggcaaatcaattactacaacaagcaaaaacccaa
attaatgcaatgattaattcaaaaacaaattatgatgttgtattcactagtggtgcaact
gaatccaataatcttgctttaaaaggtattgcctatcgtaaatttgatacagcgaaggaa
ataattacatccgtgttagagcatccgtccgtattagaggttgtaagatatttggaagca
cacgaaggatttaaagttaaatatgttgatgtaaagaaagatggcagtattaacttagaa
cacttcaaagaattaatgtcagacaaagtcggtttagtaacatgtatgtatgtaaataat
gtaactggacaaatacagcctattccacaaatggctaaagttataaaaaattatcctaag
gcacattttcatgtagatgcggttcaagcattcggcaaaatttcaatggatctcaataac
atagatagtattagtttaagtggacacaagtttaatggtttaaaaggacaaggcgtctta
cttgtaaatcacattcaaaatgttgaaccaactgtccatggtggtggtcaagaatatggc
gttagaagtggaacagttaatttgccaaatgatattgcaatggttaaagcgatgaagata
gctaatgaaaactttgaagcattgaatgcatttgttactgagttaaataatgacgtccgt
caatttttaaataaatatcatggagtttatattaattcttcaacttcaggttcaccattc
gttttaaatattagttttcctggcgtaaaaggtgaagtattagttaatgctttttcaaaa
tatgacattatgatatctacgacaagtgcttgttcatctaaacgtaataaattaaatgaa
gtattggctgcaatgggattatcagacaaatctattgaaggtagtataagattatcattt
ggggctactacaactaaagaagatatagcgaggtttaaagaaatatttatcatcatttat
gaggaaattaaggagttgctaaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1742 Cysteine desulfurase (EC 2.8.1.7)
aaggactatagcaatgttgataagagcttaaatgaagctgaacgattatttaaaaataat
cgctataagcgtgcgattgaaattgcagagcaagctcttgaaagtgttgagccaggtgtt
actaaacatattgaagaagaagttattaagcaatagaaactagtatgtagttatacttaa
ataatatgagcactctgtcaaattggactgatgagtttaataattgaagttagccaacga
tacgttgtctagcttcttttttatatggataaatgaaagggacaataaatataaatagca
attgtttaaagataaacgtaatcaaatgtgttgttttaattaatataagtagtgaaaaaa
gcataatcacacagctgtttaaatagagtgaaatagtctaattcttatttaataagtaga
aataagattattttgcgctataacctttattttttgtcggataatagtataatgcttgag
taaaacaattttaacgattgatgattaatgaaagagaagtgtttattttgatatatctag
ataatgcggcaacgacgaaagcatttgaagaagtgttagatacttatttaaaagtaaatc
aatcaatgtattataatccgaatagtccgcataaagctggtttgcaggcaaatcaattac
tacaacaagcaaaaacccaaattaatgcaatgattaattcaaaaacaaattatgatgttg
tattcactagtggtgcaactgaatccaataatcttgctttaaaaggtattgcctatcgta
aatttgatacagcgaaggaaataattacatccgtgttagagcatccgtccgtattagagg
ttgtaagatatttggaagcacacgaaggatttaaagttaaatatgttgatgtaaagaaag
atggcagtattaacttagaacacttcaaagaattaatgtcagacaaagtcggtttagtaa
catgtatgtatgtaaataatgtaactggacaaatacagcctattccacaaatggctaaag
ttataaaaaattatcctaaggcacattttcatgtagatgcggttcaagcattcggcaaaa
tttcaatggatctcaataacatagatagtattagtttaagtggacacaagtttaatggtt
taaaaggacaaggcgtcttacttgtaaatcacattcaaaatgttgaaccaactgtccatg
gtggtggtcaagaatatggcgttagaagtggaacagttaatttgccaaatgatattgcaa
tggttaaagcgatgaagatagctaatgaaaactttgaagcattgaatgcatttgttactg
agttaaataatgacgtccgtcaatttttaaataaatatcatggagtttatattaattctt
caacttcaggttcaccattcgttttaaatattagttttcctggcgtaaaaggtgaagtat
tagttaatgctttttcaaaatatgacattatgatatctacgacaagtgcttgttcatcta
aacgtaataaattaaatgaagtattggctgcaatgggattatcagacaaatctattgaag
gtagtataagattatcatttggggctactacaactaaagaagatatagcgaggtttaaag
aaatatttatcatcatttatgaggaaattaaggagttgctaaaataatgaagtatgatca
cttgcttgttagatacggggagttaacattaaagggttcaaatagaaagaaatttgtaaa
tcaattaagaaataatgtaaataagtcattaaaaggacttgatgggtttgtcgttaaagg
caaacgagatcgtatgtatattgaacttgaagaccatgcagatataaatgaaataacata
tcgattatcaaaaattttcggtattaaatctattagtccagtattaaaagtagaaaaaac
aatagaggcaataagtgcagcggcaattaaatttgcgcagcaatttgaagaaaacagcac
atttaaaattgatgtgaagcgtgccgataaaaatttcccaatggatacgtatgaattaca
gcgtgaattgggtggtgcagtattgaagcacttcgacaatatttcagtgaatgtcaaacg
tccagatcatgaaattcgagtggaagttagattagatgcaatttatatgtatgaagaagt
tgttccg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1626 Staphylococcus aureus NCTC 8325     aminotransferase, class V
fig|426430.6.peg.1561 Staphylococcus aureus subsp. aureus str. Newman FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|451515.3.peg.1813 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|451516.9.peg.1802 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|455227.3.peg.1058 Staphylococcus aureus D30 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|546342.3.peg.934 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553567.3.peg.380 Staphylococcus aureus A5948 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553590.4.peg.1937 Staphylococcus aureus A9754 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|553594.3.peg.1812 Staphylococcus aureus A9765 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|644279.4.peg.1861 Staphylococcus aureus subsp. aureus 132 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|93061.5.peg.1664 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Cysteine desulfurase (EC 2.8.1.7)
fig|93062.19.peg.1723 Staphylococcus aureus subsp. aureus COL FIG   Cysteine desulfurase (EC 2.8.1.7)
gb|EEV84233.1 Staphylococcus aureus A5948     aminotransferase class V
gi|257861425 Staphylococcus aureus A5948 NCBI   aminotransferase class V
gi|258450889 Staphylococcus aureus A5948 NCBI   aminotransferase class V
ref|ZP_05698942.1 Staphylococcus aureus A5948 RefSeq   aminotransferase class V


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
25 fig|426430.8.peg.1741 tRNA S(4)U 4-thiouridine synthase (former ThiI)
6 fig|426430.8.peg.1744 Septation ring formation regulator EzrA
4 fig|426430.8.peg.1746 SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search