The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1703: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Uncharacterized protein YmaB
Translate Function Assignments



Context on contig NC_009641 from base 1732366 to 1744492 (12127 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1698 1733712 1732366 1347 -       5: 7 11 5 18 14   Glutamyl-tRNA reductase (EC 1.2.1.70) gene_name|hemA, locus|NWMN_1566, protein_id|YP_001332600.1, gi|151221778, geneID|5331994
1699 1734519 1733929 591 - 216     1: 12   GTP-binding protein EngB gene_name|engB, locus|NWMN_1567, protein_id|YP_001332601.1, gi|151221779, geneID|5331985
1700 1735935 1734673 1263 - 153     2: 19 8   ATP-dependent Clp protease ATP-binding subunit ClpX gene_name|clpX, locus|NWMN_1568, protein_id|YP_001332602.1, gi|151221780, geneID|5330929
1701 1737387 1736086 1302 - 150     2: 15 16   Cell division trigger factor (EC 5.2.1.8) gene_name|tig, locus|NWMN_1569, protein_id|YP_001332603.1, gi|151221781, geneID|5331826
1702 1738479 1737550 930 - 162         FIG01108619: hypothetical protein locus|NWMN_1570, protein_id|YP_001332604.1, gi|151221782, geneID|5332544
1703 1739106 1738498 609 - 18         Uncharacterized protein YmaB locus|NWMN_1571, protein_id|YP_001332605.1, gi|151221783, geneID|5330930
1704 1739604 1739248 357 - 141     5: 4 3 2 9 1   LSU ribosomal protein L20p gene_name|rplT, locus|NWMN_1572, protein_id|YP_001332606.1, gi|151221784, geneID|5330931
1705 1739851 1739651 201 - 46     4: 4 3 2 1   LSU ribosomal protein L35p gene_name|rpmI, locus|NWMN_1573, protein_id|YP_001332607.1, gi|151221785, geneID|5332383
1706 1740407 1739880 528 - 28     2: 6 1   Translation initiation factor 3 gene_name|infC, locus|NWMN_1574, protein_id|YP_001332608.1, gi|151221786, geneID|5332397
1707 1742129 1740636 1494 - 228     1: 13   Lysine-specific permease gene_name|lysP, locus|NWMN_1575, protein_id|YP_001332609.1, gi|151221787, geneID|5332044
1708 1744492 1742555 1938 - 425     2: 10 17   Threonyl-tRNA synthetase (EC 6.1.1.3) gene_name|thrS, locus|NWMN_1576, protein_id|YP_001332610.1, gi|151221788, geneID|5332109

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1703 Uncharacterized protein YmaB
MSKFDEQIIVVPREIIFNNEKNTFNGFLNKNKPEGQNIFDALSQYEVKRRGDMEEDPSYK
QLISYCLLENEHGEILVYERLSGGGEARLHGQSSIGVGGHMNDVPGAESINEVLRVNAQR
ELEEEVGLSEQDSQNMEYIGFINDDNNEVGKVHIGVVFKITVSTNDVEAKETDTLRIKWV
EKGNIESYDDFETWSALILQDL

MD5 = c1edfb18b45a9eb65ab937aa33340ddf


  DNA Sequence

>fig|426430.8.peg.1703 Uncharacterized protein YmaB
atgtctaaatttgatgaacaaatcattgtagtacctagagaaattatttttaataatgaa
aagaatactttcaatgggtttttaaataagaataaaccagaaggtcaaaatatttttgat
gcgctaagtcaatatgaagttaagcgacgcggcgatatggaagaggatccatcatataaa
caactcatttcttattgtttacttgaaaatgagcatggcgagatattagtgtatgaacga
ttatctggcggtggagaagctcgattgcatggacaatcttcaataggtgtaggcggtcat
atgaatgatgttccaggagcagaatctattaacgaagtattgagagttaatgcacagaga
gaattagaagaagaagtaggtttaagtgagcaagattcacaaaatatggaatatatcggt
tttattaatgacgataataatgaagtgggcaaggtacatattggtgttgtatttaaaatc
actgtaagtacgaatgatgtagaagctaaagaaacagatactttacgaataaaatgggtt
gaaaaaggcaacatagagtcatatgatgatttcgaaacgtggagtgcattaatccttcaa
gatttataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1703 Uncharacterized protein YmaB
ttatgccacgagttaaaggtggaacagtaacaagagcgcgtcgtaaaaaaacgattaaat
tagctaaaggttacttcggttcaaaacatacattatacaaagtagctaagcaacaagtaa
tgaaatcaggtcaatatgctttccgtgaccgtcgtcaacgtaaacgtgacttccgtaaat
tatggattacacgtatcaacgcagcagctcgtcaacatgaaatgagctactcacgtttaa
tgaacggtttgaaaaaagctggtatcgacattaaccgtaaaatgttatcagaaatcgcaa
tttctgacgaaaaagcatttgctcaattagtaactaaagctaaagatgctttaaaataat
aacacttataaaaaagagatggcattgtcatctcttttttattttttaaatagcaaaatg
ccacatttaatcgctaaaatatgacatatttgctaaaatgcatttaagagaacaaacatt
aaagtgaggagttttatacgatgtctaaatttgatgaacaaatcattgtagtacctagag
aaattatttttaataatgaaaagaatactttcaatgggtttttaaataagaataaaccag
aaggtcaaaatatttttgatgcgctaagtcaatatgaagttaagcgacgcggcgatatgg
aagaggatccatcatataaacaactcatttcttattgtttacttgaaaatgagcatggcg
agatattagtgtatgaacgattatctggcggtggagaagctcgattgcatggacaatctt
caataggtgtaggcggtcatatgaatgatgttccaggagcagaatctattaacgaagtat
tgagagttaatgcacagagagaattagaagaagaagtaggtttaagtgagcaagattcac
aaaatatggaatatatcggttttattaatgacgataataatgaagtgggcaaggtacata
ttggtgttgtatttaaaatcactgtaagtacgaatgatgtagaagctaaagaaacagata
ctttacgaataaaatgggttgaaaaaggcaacatagagtcatatgatgatttcgaaacgt
ggagtgcattaatccttcaagatttataatcaaacgaggtgacatatatgtcagatatta
ttcagtttcctaactcttcgaaaaagttatataaagatataaaacgtgctgaacaagacc
aaaactatgacctgatgtatgaatatattgtgcaatatgaacgtcaatttgaactcactg
aagaaatagcaatgatgaaatgccgtatgttatatgagacggggtcatttcttgaattaa
gagaagaaacaattgtcttattgaaaactggcatacaacaatatgatgcattgatgattt
attacgtgaaaagtttgattggtttgggacaatattttgaagcggtagaagtaattcatc
aaattattgatgaagtcaaagatcacaaaacaagaatggcattacatcctcttaaagaat
ttgctaagtcaaaattaattgaagatgaaaaacgattgactcagtcattagctgattttg
atacgttatcaatgagggaacagacgcacttgattttgaagttaataga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016787       F:hydrolase activity
cmr|NT01SA1639 Staphylococcus aureus N315     NUDIX domain protein
cmr|NT02SA1654 Staphylococcus aureus Mu50     NUDIX domain protein
cmr|NT05SA1587 Staphylococcus aureus NCTC 8325     MutT/nudix family protein
cmr|SACOL1724 Staphylococcus aureus subsp. aureus COL     MutT/nudix family protein
cmr|SAUSA300_1624 Staphylococcus aureus subsp. aureus USA300-FPR3757     MutT/nudix family protein
dbj|BAB42768.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57839.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF67843.1 Staphylococcus aureus subsp. aureus str. Newman     MutT/nudix family protein
dbj|BAF78547.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.1677 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YmaB
fig|158878.14.peg.1732 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YmaB
fig|158879.1.peg.1551 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YmaB
fig|158879.11.peg.1621 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YmaB
fig|359786.13.peg.1836 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized protein YmaB
fig|359787.11.peg.1813 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized protein YmaB
fig|367830.3.peg.834 Staphylococcus aureus subsp. aureus USA300 FIG   Uncharacterized protein YmaB
fig|418127.4.peg.1545 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized protein YmaB
fig|418127.6.peg.1710 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized protein YmaB
fig|426430.6.peg.1522 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized protein YmaB
fig|450394.6.peg.931 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Uncharacterized protein YmaB
fig|451515.3.peg.1774 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Uncharacterized protein YmaB
fig|451516.9.peg.1763 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Uncharacterized protein YmaB
fig|452948.4.peg.1392 Staphylococcus aureus 930918-3 FIG   Uncharacterized protein YmaB
fig|455227.3.peg.622 Staphylococcus aureus D30 FIG   Uncharacterized protein YmaB
fig|505321.3.peg.2768 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Uncharacterized protein YmaB
fig|546342.3.peg.761 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Uncharacterized protein YmaB
fig|546343.3.peg.2637 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Uncharacterized protein YmaB
fig|548474.3.peg.2216 Staphylococcus aureus subsp. aureus TCH130 FIG   Uncharacterized protein YmaB
fig|553565.3.peg.1038 Staphylococcus aureus A5937 FIG   Uncharacterized protein YmaB
fig|553568.3.peg.722 Staphylococcus aureus A6224 FIG   Uncharacterized protein YmaB
fig|553571.3.peg.953 Staphylococcus aureus A6300 FIG   Uncharacterized protein YmaB
fig|553573.3.peg.1508 Staphylococcus aureus A8115 FIG   Uncharacterized protein YmaB
fig|553574.3.peg.520 Staphylococcus aureus A8117 FIG   Uncharacterized protein YmaB
fig|553577.3.peg.1158 Staphylococcus aureus A8796 FIG   Uncharacterized protein YmaB
fig|553580.3.peg.1131 Staphylococcus aureus A8819 FIG   Uncharacterized protein YmaB
fig|553581.3.peg.1598 Staphylococcus aureus A9299 FIG   Uncharacterized protein YmaB
fig|553583.3.peg.1618 Staphylococcus aureus A9635 FIG   Uncharacterized protein YmaB
fig|553588.3.peg.2333 Staphylococcus aureus A9719 FIG   Uncharacterized protein YmaB
fig|553590.4.peg.761 Staphylococcus aureus A9754 FIG   Uncharacterized protein YmaB
fig|553592.3.peg.2084 Staphylococcus aureus A9763 FIG   Uncharacterized protein YmaB
fig|553594.3.peg.297 Staphylococcus aureus A9765 FIG   Uncharacterized protein YmaB
fig|553596.3.peg.941 Staphylococcus aureus A9781 FIG   Uncharacterized protein YmaB
fig|553601.3.peg.1351 Staphylococcus aureus A10102 FIG   Uncharacterized protein YmaB
fig|585152.3.peg.1668 Staphylococcus aureus subsp. aureus D139 FIG   Uncharacterized protein YmaB
fig|585155.3.peg.1895 Staphylococcus aureus subsp. aureus H19 FIG   Uncharacterized protein YmaB
fig|585891.3.peg.1729 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Uncharacterized protein YmaB
fig|644279.4.peg.1824 Staphylococcus aureus subsp. aureus 132 FIG   Uncharacterized protein YmaB
fig|680649.3.peg.216 Staphylococcus aureus subsp. aureus MR1 FIG   Uncharacterized protein YmaB
fig|681288.4.peg.1671 Staphylococcus aureus subsp. aureus ED98 FIG   Uncharacterized protein YmaB
fig|703339.3.peg.1669 Staphylococcus aureus 04-02981 FIG   Uncharacterized protein YmaB
fig|762962.3.peg.310 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Uncharacterized protein YmaB
fig|93061.3.peg.1565 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YmaB
fig|93061.5.peg.1625 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YmaB
fig|93062.19.peg.1684 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized protein YmaB
fig|93062.4.peg.1805 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized protein YmaB
gb|AAW36829.1 Staphylococcus aureus subsp. aureus COL     MutT/nudix family protein
gb|ABD20876.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     MutT/nudix family protein
gb|ABD30851.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ49525.1 Staphylococcus aureus subsp. aureus JH9     NUDIX hydrolase
gb|ABR52613.1 Staphylococcus aureus subsp. aureus JH1     NUDIX hydrolase
gb|EES92658.1 Staphylococcus aureus subsp. aureus USA300_TCH959     MutT/nudix family hydrolase
gb|EES96208.1 Staphylococcus aureus subsp. aureus TCH130     MutT/nudix family hydrolase
gb|EEV26375.1 Staphylococcus aureus A9781     NUDIX hydrolase
gb|EEV63833.1 Staphylococcus aureus A9763     NUDIX hydrolase
gb|EEV66469.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV69747.1 Staphylococcus aureus A9635     NUDIX hydrolase
gb|EEV72281.1 Staphylococcus aureus A9299     MutT/nudix family protein
gb|EEV75053.1 Staphylococcus aureus A8115     MutT/nudix family protein
gb|EEV78096.1 Staphylococcus aureus A6300     NUDIX hydrolase
gb|EEV81257.1 Staphylococcus aureus A6224     NUDIX hydrolase
gb|EEV86285.1 Staphylococcus aureus A5937     NUDIX hydrolase
gb|EEW44889.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0209
gb|EEW47858.1 Staphylococcus aureus D30     hypothetical protein SAD30_1048
gi|13701474 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14247449 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147741227 Staphylococcus aureus subsp. aureus JH9 NCBI   NUDIX hydrolase
gi|148268158 Staphylococcus aureus subsp. aureus JH9 NCBI   NUDIX hydrolase
gi|149946677 Staphylococcus aureus subsp. aureus JH1 NCBI   NUDIX hydrolase
gi|150374583 Staphylococcus aureus subsp. aureus str. Newman NCBI   MutT/nudix family protein
gi|150394225 Staphylococcus aureus subsp. aureus JH1 NCBI   NUDIX hydrolase
gi|151221783 Staphylococcus aureus subsp. aureus str. Newman NCBI   MutT/nudix family protein
gi|156722130 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979995 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1664
gi|15924667 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1677
gi|15927256 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1501
gi|221137783 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_03863
gi|221142572 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_13187
gi|253317179 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   MutT/nudix family protein
gi|253723929 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MutT/nudix family hydrolase
gi|253727479 Staphylococcus aureus subsp. aureus TCH130 NCBI   MutT/nudix family hydrolase
gi|253732329 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MutT/nudix family hydrolase
gi|253734538 Staphylococcus aureus subsp. aureus TCH130 NCBI   MutT/nudix family hydrolase
gi|255006462 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   MutT/nudix family protein
gi|257788035 Staphylococcus aureus A9781 NCBI   NUDIX hydrolase
gi|257794063 Staphylococcus aureus A9781 NCBI   NUDIX hydrolase
gi|257839360 Staphylococcus aureus A9763 NCBI   NUDIX hydrolase
gi|257842040 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257845715 Staphylococcus aureus A9635 NCBI   NUDIX hydrolase
gi|257848290 Staphylococcus aureus A9299 NCBI   MutT/nudix family protein
gi|257851110 Staphylococcus aureus A8115 NCBI   MutT/nudix family protein
gi|257855157 Staphylococcus aureus A6300 NCBI   NUDIX hydrolase
gi|257858372 Staphylococcus aureus A6224 NCBI   NUDIX hydrolase
gi|257863526 Staphylococcus aureus A5937 NCBI   NUDIX hydrolase
gi|258415767 Staphylococcus aureus A9763 NCBI   NUDIX hydrolase
gi|258421996 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258424094 Staphylococcus aureus A9635 NCBI   NUDIX hydrolase
gi|258438246 Staphylococcus aureus A9299 NCBI   MutT/nudix family protein
gi|258443704 Staphylococcus aureus A8115 NCBI   MutT/nudix family protein
gi|258445915 Staphylococcus aureus A6300 NCBI   NUDIX hydrolase
gi|258448404 Staphylococcus aureus A6224 NCBI   NUDIX hydrolase
gi|258454296 Staphylococcus aureus A5937 NCBI   NUDIX hydrolase
gi|259159850 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0209
gi|259163299 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1048
gi|57284735 Staphylococcus aureus subsp. aureus COL NCBI   MutT/nudix family protein
gi|57650549 Staphylococcus aureus subsp. aureus COL NCBI   MutT/nudix family protein
gi|87126362 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   MutT/nudix family protein
gi|87160388 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   MutT/nudix family protein
gi|87203041 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195483 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01782
img|637093171 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100186 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637152462 Staphylococcus aureus aureus COL IMG   MutT/nudix family protein
img|637888274 Staphylococcus aureus aureus USA300 IMG   MutT/nudix family protein
img|637894381 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640566078 Staphylococcus aureus aureus JH9 IMG   NUDIX hydrolase
img|640779847 Staphylococcus aureus aureus JH1 IMG   NUDIX hydrolase
img|640795952 Staphylococcus aureus aureus Newman IMG   MutT/nudix family protein
img|640904408 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641772809 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1624 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   MutT/NUDIX family protein
kegg|sac:SACOL1724 Staphylococcus aureus subsp. aureus COL KEGG   MutT/NUDIX family protein
kegg|sae:NWMN_1571 Staphylococcus aureus subsp. aureus Newman KEGG   MutT/NUDIX family protein
kegg|sah:SaurJH1_1769 Staphylococcus aureus subsp. aureus JH1 KEGG   NUDIX hydrolase
kegg|saj:SaurJH9_1735 Staphylococcus aureus subsp. aureus JH9 KEGG   NUDIX hydrolase
kegg|sao:SAOUHSC_01782 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA1501   KEGG   hypothetical protein
kegg|sav:SAV1677   KEGG   hypothetical protein
kegg|saw:SAHV_1664 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372201.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1677
ref|NP_374789.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1501
ref|YP_001247101.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   NUDIX hydrolase
ref|YP_001316900.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   NUDIX hydrolase
ref|YP_001332605.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   MutT/nudix family protein
ref|YP_001442254.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1664
ref|YP_186562.1 Staphylococcus aureus subsp. aureus COL RefSeq   MutT/nudix family protein
ref|YP_494319.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   MutT/nudix family protein
ref|YP_500287.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01782
ref|ZP_03562585.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_03863
ref|ZP_03567065.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_13187
ref|ZP_04840392.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   MutT/nudix family protein
ref|ZP_04866494.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   MutT/nudix family hydrolase
ref|ZP_04868703.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   MutT/nudix family hydrolase
ref|ZP_05145063.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   MutT/nudix family protein
ref|ZP_05643042.1 Staphylococcus aureus A9781 RefSeq   NUDIX hydrolase
ref|ZP_05682038.1 Staphylococcus aureus A9763 RefSeq   NUDIX hydrolase
ref|ZP_05684916.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05686976.1 Staphylococcus aureus A9635 RefSeq   NUDIX hydrolase
ref|ZP_05689530.1 Staphylococcus aureus A9299 RefSeq   MutT/nudix family protein
ref|ZP_05692043.1 Staphylococcus aureus A8115 RefSeq   MutT/nudix family protein
ref|ZP_05694091.1 Staphylococcus aureus A6300 RefSeq   NUDIX hydrolase
ref|ZP_05696521.1 Staphylococcus aureus A6224 RefSeq   NUDIX hydrolase
ref|ZP_05702265.1 Staphylococcus aureus A5937 RefSeq   NUDIX hydrolase
tr|A5ITK2 Staphylococcus aureus (strain JH9) TrEMBL   NUDIX hydrolase
tr|A6QHL1 Staphylococcus aureus (strain Newman) TrEMBL   MutT/nudix family protein
tr|A6U2E5 Staphylococcus aureus (strain JH1) TrEMBL   NUDIX hydrolase
tr|A7X3A0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C5N6A2 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   MutT/nudix family hydrolase
tr|C5Q3I4 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   MutT/nudix family hydrolase
tr|Q2FG59 Staphylococcus aureus (strain USA300) TrEMBL   MutT/nudix family protein
tr|Q2FXQ3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HF95 Staphylococcus aureus (strain COL) TrEMBL   MutT/nudix family protein
tr|Q7A569 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1501
tr|Q99TI4 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search