The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1596: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Glycyl-tRNA synthetase (EC 6.1.1.14)
Translate Function Assignments



Context on contig NC_009641 from base 1631297 to 1642668 (11372 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1592 1632403 1631297 1107 -       3: 12 2 3   RNA polymerase sigma factor RpoD gene_name|sigA, locus|NWMN_1464, protein_id|YP_001332498.1, gi|151221676, geneID|5330874
1593 1634426 1632627 1800 - 223     4: 22 10 2 3   DNA primase (EC 2.7.7.-) gene_name|dnaG, locus|NWMN_1465, protein_id|YP_001332499.1, gi|151221677, geneID|5332485
1594 1635305 1634487 819 - 60         ATP/GTP-binding protein, SA1392 homolog locus|NWMN_1466, protein_id|YP_001332500.1, gi|151221678, geneID|5331872
1595 1635855 1635316 540 - 10         CBS domain protein, lmo1865 homolog locus|NWMN_1467, protein_id|YP_001332501.1, gi|151221679, geneID|5330875
1596 1636274 1637665 1392 + 418   1: 8   Glycyl-tRNA synthetase (EC 6.1.1.14) gene_name|glyS, locus|NWMN_1468, protein_id|YP_001332502.1, gi|151221680, geneID|5330876
1597 1638561 1637815 747 - 149     2: 21 4   DNA recombination and repair protein RecO gene_name|recO, locus|NWMN_1469, protein_id|YP_001332503.1, gi|151221681, geneID|5331967
1598 1639488 1638589 900 - 27 7 6: 17 18 11 5 4 20   GTP-binding protein Era gene_name|era, locus|NWMN_1470, protein_id|YP_001332504.1, gi|151221682, geneID|5332343
1599 1639893 1639489 405 - 0     5: 7 15 16 19 6   Cytidine deaminase (EC 3.5.4.5) locus|NWMN_1471, protein_id|YP_001332505.1, gi|151221683, geneID|5330877
1600 1640248 1639904 345 - 10     1: 9   Undecaprenol kinase (EC 2.7.1.66) locus|NWMN_1472, protein_id|YP_001332506.1, gi|151221684, geneID|5330878
1601 1640718 1640251 468 - 2 7 1: 1   Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly locus|NWMN_1473, protein_id|YP_001332507.1, gi|151221685, geneID|5330879
1602 1641666 1640719 948 - 0     3: 14 1 13   PhoH-like protein, PhoL gene_name|phoH, locus|NWMN_1474, protein_id|YP_001332508.1, gi|151221686, geneID|5330880
1603 1642668 1641970 699 - 303         Uncharacterized membrane anchored protein YqfB locus|NWMN_1475, protein_id|YP_001332509.1, gi|151221687, geneID|5332270

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
tRNA_synthetase_relationships howard.969 Glycyl-tRNA synthetase (EC 6.1.1.14)


  Protein Sequence

>fig|426430.8.peg.1596 Glycyl-tRNA synthetase (EC 6.1.1.14)
MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF

MD5 = 041051bfb578786a07f43773f87a365f


  DNA Sequence

>fig|426430.8.peg.1596 Glycyl-tRNA synthetase (EC 6.1.1.14)
atggcaaaagatatggatacaattgtttcattagcaaaacacagaggttttgtgttccct
ggtagtgatatttacggtggtttatcaaacacatgggattatggtcctttaggtgttgaa
ttaaagaataatgttaaaaaagcttggtggcaaaaattcattacacaatcaccgtttaac
gttggtatcgatgctgcaatcttaatgaatccaaaagtatgggaagcttcaggacactta
aacaacttcaacgacccaatgattgataataaagatagtaaaattcgatatcgcgctgat
aaattaattgaagattatatgcaagatgttaaaggtgatgaaaacttcattgccgatggt
ttaagttttgaacaaatgaaaaaaattattgacgatgaaggtattgtttgtcctgtaagt
aaaactgctaactggactgaaattcgccaattcaatttaatgtttaaaacattccaaggt
gtaactgaagattctacaaatgaaattttcttacgtcctgaaacagcacaaggtattttt
gtaaactataaaaacgtgcaacgttcaatgcgtaaaaaattaccatttggtatcggtcaa
attggtaaatcattccgtaatgaaatcactccaggtaacttcattttcagaacaagagaa
tttgaacaaatggaacttgaattcttctgtaaacctggagaagaaatcgaatggcaaaat
tattggaaaacttttgcaagtgactggttaacaagcttaaatatgagcagtgaaaatatg
cgtttacgtgatcatgatgaagatgaattatctcattactcaaatgcaacaactgatatt
gaatataaattcccatttggttggggtgagttatggggtatcgcaagtcgtacagacttc
gacttacgtaaacatgctgaacactctggtgaagatttcagataccatgatccagaaacg
aacgaaaaatatattccatattgtatcgagccatcacttggtgcagatcgtgtaacatta
gctttcttatgtgatgcatatgatgaagaaggcgttgaaggtagtaaagatgcacgtaca
gttttacacttccatcctgcattagcaccatataaagcagcgattttacctttaagtaag
aaattatctggcgaagcgattaagatttttgagcaattaagttctaaattctcaatcgat
ttcgatgaatcacaatctatcggtaaaagataccgtcgtcaagatgaaatcggtacacct
tattgtgtaacattcgactttgattcattagaagataatcaagttacagtacgtgacaga
gattcaatggaacaagttcgtatgccaatctcagagttagaagctttcttaactgaaaaa
acaaaattctaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1596 Glycyl-tRNA synthetase (EC 6.1.1.14)
caactcggggacgcgcttctaaaaaacctgacattgttaatatcgctaaatctggtctaa
gcgttgctcttgttaaattcaacttatctgctatttgttcaccagtaatgggtcctttag
ttttaacaatttcgatgattcgttcttgtctttgactgagttctataggtcttcacccct
tttttattcacctattattataccgatatttctttcatgtcacaaacacattaattttac
ttgcctttaaataatctatcaattagaataaacgtacagcgagttaaggatagtgtaagc
ttaacaataagattggcgcaacgaatcattttaaaataaaagcgagtgactacactaatt
tgggtggaaccgcgggttaaatacgtaacttattttgtattatatacaatttaaaatatt
aactcgtcccatggaagtaaagcatatttactatgctgttattttccatggggcgttttc
atgtatgaggagaggtaattatggcaaaagatatggatacaattgtttcattagcaaaac
acagaggttttgtgttccctggtagtgatatttacggtggtttatcaaacacatgggatt
atggtcctttaggtgttgaattaaagaataatgttaaaaaagcttggtggcaaaaattca
ttacacaatcaccgtttaacgttggtatcgatgctgcaatcttaatgaatccaaaagtat
gggaagcttcaggacacttaaacaacttcaacgacccaatgattgataataaagatagta
aaattcgatatcgcgctgataaattaattgaagattatatgcaagatgttaaaggtgatg
aaaacttcattgccgatggtttaagttttgaacaaatgaaaaaaattattgacgatgaag
gtattgtttgtcctgtaagtaaaactgctaactggactgaaattcgccaattcaatttaa
tgtttaaaacattccaaggtgtaactgaagattctacaaatgaaattttcttacgtcctg
aaacagcacaaggtatttttgtaaactataaaaacgtgcaacgttcaatgcgtaaaaaat
taccatttggtatcggtcaaattggtaaatcattccgtaatgaaatcactccaggtaact
tcattttcagaacaagagaatttgaacaaatggaacttgaattcttctgtaaacctggag
aagaaatcgaatggcaaaattattggaaaacttttgcaagtgactggttaacaagcttaa
atatgagcagtgaaaatatgcgtttacgtgatcatgatgaagatgaattatctcattact
caaatgcaacaactgatattgaatataaattcccatttggttggggtgagttatggggta
tcgcaagtcgtacagacttcgacttacgtaaacatgctgaacactctggtgaagatttca
gataccatgatccagaaacgaacgaaaaatatattccatattgtatcgagccatcacttg
gtgcagatcgtgtaacattagctttcttatgtgatgcatatgatgaagaaggcgttgaag
gtagtaaagatgcacgtacagttttacacttccatcctgcattagcaccatataaagcag
cgattttacctttaagtaagaaattatctggcgaagcgattaagatttttgagcaattaa
gttctaaattctcaatcgatttcgatgaatcacaatctatcggtaaaagataccgtcgtc
aagatgaaatcggtacaccttattgtgtaacattcgactttgattcattagaagataatc
aagttacagtacgtgacagagattcaatggaacaagttcgtatgccaatctcagagttag
aagctttcttaactgaaaaaacaaaattctaattaaaaagactttccaccatatgtggtg
gctatataatttataaaaagagatactggttagtaaaattgccagtatctcttttctatt
caaaaaggtattcaaataaacacatctatgtggctacttgaataccttttattattttat
gttattgttccaatctttttaattggttgattagtttctgacttttaaaaaacatacctg
catattcacgatataacattaaaatgatatctgacatttcatcaataatttcttgatgga
tattcaatgaattcattttatctatcggtaatttttgtaatacatctaataaatatagtg
ttttattcgataatataactgcatgtacatctttagaagcctcttgccttgaaatcgcac
cgtcaaacttaaaactataacctattaaatctgcttgtgtgtcattaccactcacagcac
agcgattaaatgatgcagtaaaaccaaatcgtttcatgcactttaacataac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004820       F:glycine-tRNA ligase activity
GO:0005524       F:ATP binding
GO:0005737       C:cytoplasm
GO:0006426       P:glycyl-tRNA aminoacylation
cmr|NT01SA1525 Staphylococcus aureus N315     glycyl-tRNA synthetase
cmr|NT02SA1550 Staphylococcus aureus Mu50     glycyl-tRNA synthetase
cmr|NT03SA1649 Staphylococcus aureus MW2     glycyl-tRNA synthetase
cmr|NT05SA1484 Staphylococcus aureus NCTC 8325     glycyl-tRNA synthetase
cmr|NT08SA1598 Staphylococcus aureus subsp. aureus MRSA252     glycyl-tRNA synthetase
cmr|NT09SA1490 Staphylococcus aureus subsp. aureus MSSA476     glycyl-tRNA synthetase
cmr|SACOL1622 Staphylococcus aureus subsp. aureus COL     glycyl-tRNA synthetase
cmr|SAUSA300_1525 Staphylococcus aureus subsp. aureus USA300-FPR3757     glycyl-tRNA synthetase
dbj|BAB42657.1 Staphylococcus aureus subsp. aureus N315     glycyl-tRNA synthetase
dbj|BAB57727.1 Staphylococcus aureus subsp. aureus Mu50     glycyl-tRNA synthetase
dbj|BAB95382.1 Staphylococcus aureus subsp. aureus MW2     glycyl-tRNA synthetase
dbj|BAF67740.1 Staphylococcus aureus subsp. aureus str. Newman     glycyl-tRNA synthetase
dbj|BAF78435.1 Staphylococcus aureus subsp. aureus Mu3     glycyl-tRNA synthetase
emb|CAG40637.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative glycyl-tRNA synthetase
emb|CAG43304.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative glycyl-tRNA synthetase
fig|158878.1.peg.1565 Staphylococcus aureus subsp. aureus Mu50 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|158878.14.peg.1611 Staphylococcus aureus subsp. aureus Mu50 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|158879.1.peg.1440 Staphylococcus aureus subsp. aureus N315 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|158879.11.peg.1500 Staphylococcus aureus subsp. aureus N315 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|196620.1.peg.1517 Staphylococcus aureus subsp. aureus MW2 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|196620.5.peg.1583 Staphylococcus aureus subsp. aureus MW2 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|282458.1.peg.1555 Staphylococcus aureus subsp. aureus MRSA252 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|282458.4.peg.1646 Staphylococcus aureus subsp. aureus MRSA252 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|282459.1.peg.1488 Staphylococcus aureus subsp. aureus MSSA476 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|282459.5.peg.1563 Staphylococcus aureus subsp. aureus MSSA476 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|359786.13.peg.1714 Staphylococcus aureus subsp. aureus JH9 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|359786.3.peg.287 Staphylococcus aureus subsp. aureus JH9 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|359787.11.peg.1691 Staphylococcus aureus subsp. aureus JH1 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|359787.3.peg.1460 Staphylococcus aureus subsp. aureus JH1 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|367830.3.peg.303 Staphylococcus aureus subsp. aureus USA300 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|418127.4.peg.1443 Staphylococcus aureus subsp. aureus Mu3 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|418127.6.peg.1589 Staphylococcus aureus subsp. aureus Mu3 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|426430.6.peg.1425 Staphylococcus aureus subsp. aureus str. Newman FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|450394.6.peg.820 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|451515.3.peg.1666 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|451516.9.peg.1656 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|452948.4.peg.212 Staphylococcus aureus 930918-3 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|455227.3.peg.1152 Staphylococcus aureus D30 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|505321.3.peg.389 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|546342.3.peg.855 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|546343.3.peg.19 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|548470.3.peg.2364 Staphylococcus aureus subsp. aureus MN8 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|548474.3.peg.745 Staphylococcus aureus subsp. aureus TCH130 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|548475.3.peg.554 Staphylococcus aureus subsp. aureus TCH70 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553565.3.peg.263 Staphylococcus aureus A5937 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553567.3.peg.96 Staphylococcus aureus A5948 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553568.3.peg.1041 Staphylococcus aureus A6224 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553571.3.peg.1846 Staphylococcus aureus A6300 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553573.3.peg.1395 Staphylococcus aureus A8115 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553574.3.peg.409 Staphylococcus aureus A8117 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553577.3.peg.1800 Staphylococcus aureus A8796 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553580.3.peg.1826 Staphylococcus aureus A8819 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553581.3.peg.1433 Staphylococcus aureus A9299 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553588.3.peg.460 Staphylococcus aureus A9719 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553590.4.peg.653 Staphylococcus aureus A9754 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553592.3.peg.1370 Staphylococcus aureus A9763 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553594.3.peg.190 Staphylococcus aureus A9765 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553596.3.peg.496 Staphylococcus aureus A9781 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|553601.3.peg.1697 Staphylococcus aureus A10102 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585143.3.peg.2099 Staphylococcus aureus subsp. aureus 55/2053 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585144.3.peg.2125 Staphylococcus aureus subsp. aureus 58-424 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585145.3.peg.1828 Staphylococcus aureus subsp. aureus 65-1322 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585146.3.peg.2097 Staphylococcus aureus subsp. aureus 68-397 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585147.3.peg.1171 Staphylococcus aureus subsp. aureus A017934/97 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585148.3.peg.1148 Staphylococcus aureus subsp. aureus Btn1260 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585149.6.peg.1736 Staphylococcus aureus subsp. aureus C101 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585150.3.peg.1823 Staphylococcus aureus subsp. aureus C160 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585151.3.peg.782 Staphylococcus aureus subsp. aureus C427 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585152.3.peg.1556 Staphylococcus aureus subsp. aureus D139 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585153.3.peg.1843 Staphylococcus aureus subsp. aureus E1410 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585154.3.peg.1264 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585155.3.peg.1784 Staphylococcus aureus subsp. aureus H19 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585156.3.peg.1117 Staphylococcus aureus subsp. aureus M1015 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585157.3.peg.1296 Staphylococcus aureus subsp. aureus M809 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585158.3.peg.2084 Staphylococcus aureus subsp. aureus M876 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585159.3.peg.1640 Staphylococcus aureus subsp. aureus M899 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585160.3.peg.1105 Staphylococcus aureus subsp. aureus WBG10049 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585161.3.peg.1284 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|585891.3.peg.1608 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|644279.4.peg.1716 Staphylococcus aureus subsp. aureus 132 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|680649.3.peg.1162 Staphylococcus aureus subsp. aureus MR1 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|681288.4.peg.1555 Staphylococcus aureus subsp. aureus ED98 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|703339.3.peg.1550 Staphylococcus aureus 04-02981 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|762962.3.peg.421 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|93061.3.peg.1613 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|93061.5.peg.1516 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|93062.19.peg.1577 Staphylococcus aureus subsp. aureus COL FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
fig|93062.4.peg.1323 Staphylococcus aureus subsp. aureus COL FIG   Glycyl-tRNA synthetase (EC 6.1.1.14)
gb|AAW38238.1 Staphylococcus aureus subsp. aureus COL     glycyl-tRNA synthetase
gb|ABD22244.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     glycyl-tRNA synthetase
gb|ABD30741.1 Staphylococcus aureus subsp. aureus NCTC 8325     glycyl-tRNA synthetase
gb|ABQ49416.1 Staphylococcus aureus subsp. aureus JH9     glycyl-tRNA synthetase
gb|ABR52505.1 Staphylococcus aureus subsp. aureus JH1     glycyl-tRNA synthetase
gb|ABX29573.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glycine--tRNA ligase
gb|EEI95654.1 Staphylococcus aureus subsp. aureus MN8     glycyl-tRNA synthetase
gb|EES54666.1 Staphylococcus aureus subsp. aureus TCH70     glycyl-tRNA synthetase
gb|EES92736.1 Staphylococcus aureus subsp. aureus USA300_TCH959     glycyl-tRNA synthetase
gb|EES97454.1 Staphylococcus aureus subsp. aureus TCH130     glycyl-tRNA synthetase
gb|EEV03530.1 Staphylococcus aureus subsp. aureus 55/2053     glycyl-tRNA synthetase
gb|EEV06679.1 Staphylococcus aureus subsp. aureus 65-1322     glycyl-tRNA synthetase
gb|EEV09054.1 Staphylococcus aureus subsp. aureus 68-397     glycyl-tRNA synthetase
gb|EEV11906.1 Staphylococcus aureus subsp. aureus E1410     glycyl-tRNA synthetase
gb|EEV14064.1 Staphylococcus aureus subsp. aureus M876     glycyl-tRNA synthetase
gb|EEV25953.1 Staphylococcus aureus A9781     glycyl-tRNA synthetase
gb|EEV64673.1 Staphylococcus aureus A9763     glycyl-tRNA synthetase
gb|EEV68242.1 Staphylococcus aureus A9719     glycyl-tRNA synthetase
gb|EEV72590.1 Staphylococcus aureus A9299     glycyl-tRNA synthetase
gb|EEV74952.1 Staphylococcus aureus A8115     glycyl-tRNA synthetase
gb|EEV77334.1 Staphylococcus aureus A6300     glycyl-tRNA synthetase
gb|EEV80891.1 Staphylococcus aureus A6224     glycyl-tRNA synthetase
gb|EEV84563.1 Staphylococcus aureus A5948     glycyl-tRNA synthetase
gb|EEV87022.1 Staphylococcus aureus A5937     glycyl-tRNA synthetase
gb|EEW45821.1 Staphylococcus aureus 930918-3     glycyl-tRNA synthetase
gb|EEW47374.1 Staphylococcus aureus D30     glycyl-tRNA synthetase
gi|123291788 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|123749609 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|13701363 Staphylococcus aureus subsp. aureus N315 NCBI   glycyl-tRNA synthetase
gi|14247336 Staphylococcus aureus subsp. aureus Mu50 NCBI   glycyl-tRNA synthetase
gi|147741118 Staphylococcus aureus subsp. aureus JH9 NCBI   glycyl-tRNA synthetase
gi|148268049 Staphylococcus aureus subsp. aureus JH9 NCBI   glycyl-tRNA synthetase
gi|149946569 Staphylococcus aureus subsp. aureus JH1 NCBI   glycyl-tRNA synthetase
gi|150374480 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycyl-tRNA synthetase
gi|150394117 Staphylococcus aureus subsp. aureus JH1 NCBI   glycyl-tRNA synthetase
gi|151221680 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycyl-tRNA synthetase
gi|156722018 Staphylococcus aureus subsp. aureus Mu3 NCBI   glycyl-tRNA synthetase
gi|156979883 Staphylococcus aureus subsp. aureus Mu3 NCBI   glycyl-tRNA synthetase
gi|15924555 Staphylococcus aureus subsp. aureus Mu50 NCBI   glycyl-tRNA synthetase
gi|15927145 Staphylococcus aureus subsp. aureus N315 NCBI   glycyl-tRNA synthetase
gi|160368602 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycine--tRNA ligase
gi|161509793 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycyl-tRNA synthetase
gi|166227939 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|172048905 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|189082278 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|189082279 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|189082280 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|21204686 Staphylococcus aureus subsp. aureus MW2 NCBI   glycyl-tRNA synthetase
gi|21283246 Staphylococcus aureus subsp. aureus MW2 NCBI   glycyl-tRNA synthetase
gi|221137872 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glycyl-tRNA synthetase
gi|221140015 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glycyl-tRNA synthetase
gi|227245895 Staphylococcus aureus subsp. aureus MN8 NCBI   glycyl-tRNA synthetase
gi|227557763 Staphylococcus aureus subsp. aureus MN8 NCBI   glycyl-tRNA synthetase
gi|251802009 Staphylococcus aureus subsp. aureus TCH70 NCBI   glycyl-tRNA synthetase
gi|251814561 Staphylococcus aureus subsp. aureus TCH70 NCBI   glycyl-tRNA synthetase
gi|253314936 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   glycyl-tRNA synthetase
gi|253724007 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   glycyl-tRNA synthetase
gi|253728725 Staphylococcus aureus subsp. aureus TCH130 NCBI   glycyl-tRNA synthetase
gi|253732218 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   glycyl-tRNA synthetase
gi|253733185 Staphylococcus aureus subsp. aureus TCH130 NCBI   glycyl-tRNA synthetase
gi|255006351 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   glycyl-tRNA synthetase
gi|257271384 Staphylococcus aureus subsp. aureus 55/2053 NCBI   glycyl-tRNA synthetase
gi|257275192 Staphylococcus aureus subsp. aureus 65-1322 NCBI   glycyl-tRNA synthetase
gi|257278418 Staphylococcus aureus subsp. aureus 68-397 NCBI   glycyl-tRNA synthetase
gi|257281769 Staphylococcus aureus subsp. aureus E1410 NCBI   glycyl-tRNA synthetase
gi|257283941 Staphylococcus aureus subsp. aureus M876 NCBI   glycyl-tRNA synthetase
gi|257425690 Staphylococcus aureus subsp. aureus 55/2053 NCBI   glycyl-tRNA synthetase
gi|257428351 Staphylococcus aureus subsp. aureus 65-1322 NCBI   glycyl-tRNA synthetase
gi|257430988 Staphylococcus aureus subsp. aureus 68-397 NCBI   glycyl-tRNA synthetase
gi|257433676 Staphylococcus aureus subsp. aureus E1410 NCBI   glycyl-tRNA synthetase
gi|257436590 Staphylococcus aureus subsp. aureus M876 NCBI   glycyl-tRNA synthetase
gi|257787613 Staphylococcus aureus A9781 NCBI   glycyl-tRNA synthetase
gi|257793641 Staphylococcus aureus A9781 NCBI   glycyl-tRNA synthetase
gi|257840209 Staphylococcus aureus A9763 NCBI   glycyl-tRNA synthetase
gi|257843848 Staphylococcus aureus A9719 NCBI   glycyl-tRNA synthetase
gi|257848602 Staphylococcus aureus A9299 NCBI   glycyl-tRNA synthetase
gi|257851009 Staphylococcus aureus A8115 NCBI   glycyl-tRNA synthetase
gi|257854385 Staphylococcus aureus A6300 NCBI   glycyl-tRNA synthetase
gi|257858002 Staphylococcus aureus A6224 NCBI   glycyl-tRNA synthetase
gi|257861764 Staphylococcus aureus A5948 NCBI   glycyl-tRNA synthetase
gi|257864272 Staphylococcus aureus A5937 NCBI   glycyl-tRNA synthetase
gi|258411059 Staphylococcus aureus A9763 NCBI   glycyl-tRNA synthetase
gi|258420137 Staphylococcus aureus A9719 NCBI   glycyl-tRNA synthetase
gi|258437397 Staphylococcus aureus A9299 NCBI   glycyl-tRNA synthetase
gi|258443603 Staphylococcus aureus A8115 NCBI   glycyl-tRNA synthetase
gi|258446810 Staphylococcus aureus A6300 NCBI   glycyl-tRNA synthetase
gi|258448724 Staphylococcus aureus A6224 NCBI   glycyl-tRNA synthetase
gi|258450606 Staphylococcus aureus A5948 NCBI   glycyl-tRNA synthetase
gi|258453541 Staphylococcus aureus A5937 NCBI   glycyl-tRNA synthetase
gi|259160801 Staphylococcus aureus 930918-3 NCBI   glycyl-tRNA synthetase
gi|259162809 Staphylococcus aureus D30 NCBI   glycyl-tRNA synthetase
gi|49241942 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative glycyl-tRNA synthetase
gi|49244843 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative glycyl-tRNA synthetase
gi|49483813 Staphylococcus aureus subsp. aureus MRSA252 NCBI   glycyl-tRNA synthetase
gi|49486400 Staphylococcus aureus subsp. aureus MSSA476 NCBI   glycyl-tRNA synthetase
gi|54039670 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|54039676 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|54042030 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|56749385 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|56749414 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|57286144 Staphylococcus aureus subsp. aureus COL NCBI   glycyl-tRNA synthetase
gi|57651958 Staphylococcus aureus subsp. aureus COL NCBI   glycyl-tRNA synthetase
gi|71153560 organism not parsed/found in ncbi nr NCBI   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
gi|87127730 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycyl-tRNA synthetase
gi|87161756 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   glycyl-tRNA synthetase
gi|87202931 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glycyl-tRNA synthetase
gi|88195373 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glycyl-tRNA synthetase
img|637093060 Staphylococcus aureus aureus N315 IMG   glycyl-tRNA synthetase
img|637100074 Staphylococcus aureus aureus Mu50 IMG   glycyl-tRNA synthetase
img|637152362 Staphylococcus aureus aureus COL IMG   glycyl-tRNA synthetase( EC:6.1.1.14 )
img|637155062 Staphylococcus aureus aureus MRSA252 IMG   glycyl-tRNA synthetase
img|637157725 Staphylococcus aureus aureus MSSA476 IMG   glycyl-tRNA synthetase
img|637299281 Staphylococcus aureus aureus MW2 IMG   glycyl-tRNA synthetase
img|637888175 Staphylococcus aureus aureus USA300 IMG   glycyl-tRNA synthetase( EC:6.1.1.14 )
img|637894271 Staphylococcus aureus aureus NCTC 8325 IMG   glycyl-tRNA synthetase( EC:6.1.1.14 )
img|639107769 Staphylococcus aureus aureus JH1 IMG   Glycyl-tRNA synthetase, alpha2 dimer( EC:6.1.1.14 )
img|640565969 Staphylococcus aureus aureus JH9 IMG   glycyl-tRNA synthetase
img|640779739 Staphylococcus aureus aureus JH1 IMG   glycyl-tRNA synthetase
img|640795849 Staphylococcus aureus aureus Newman IMG   glycyl-tRNA synthetase
img|640904296 Staphylococcus aureus aureus Mu3 IMG   glycyl-tRNA synthetase
img|641309525 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glycine--tRNA ligase( EC:6.1.1.14 )
img|641772483 Staphylococcus aureus aureus USA300_TCH959 IMG   glycine--tRNA ligase
kegg|saa:SAUSA300_1525 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sac:SACOL1622 Staphylococcus aureus subsp. aureus COL KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sae:NWMN_1468 Staphylococcus aureus subsp. aureus Newman KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sah:SaurJH1_1657 Staphylococcus aureus subsp. aureus JH1 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|saj:SaurJH9_1623 Staphylococcus aureus subsp. aureus JH9 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sam:MW1517 Staphylococcus aureus subsp. aureus MW2 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sao:SAOUHSC_01666 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sar:SAR1642   KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sas:SAS1503   KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sau:SA1394   KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|sav:SAV1565   KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
kegg|saw:SAHV_1552 Staphylococcus aureus subsp. aureus Mu3 KEGG   glycyl-tRNA synthetase
kegg|sax:USA300HOU_1566 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glycyl-tRNA synthetase (EC:6.1.1.14)
ref|NP_372089.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   glycyl-tRNA synthetase
ref|NP_374678.1 Staphylococcus aureus subsp. aureus N315 RefSeq   glycyl-tRNA synthetase
ref|NP_646334.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   glycyl-tRNA synthetase
ref|YP_001246992.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   glycyl-tRNA synthetase
ref|YP_001316792.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   glycyl-tRNA synthetase
ref|YP_001332502.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   glycyl-tRNA synthetase
ref|YP_001442142.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   glycyl-tRNA synthetase
ref|YP_001575452.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glycyl-tRNA synthetase
ref|YP_041037.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   glycyl-tRNA synthetase
ref|YP_043621.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   glycyl-tRNA synthetase
ref|YP_186462.1 Staphylococcus aureus subsp. aureus COL RefSeq   glycyl-tRNA synthetase
ref|YP_494220.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   glycyl-tRNA synthetase
ref|YP_500177.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   glycyl-tRNA synthetase
ref|ZP_03562674.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glycyl-tRNA synthetase
ref|ZP_03564508.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glycyl-tRNA synthetase
ref|ZP_03987810.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   glycyl-tRNA synthetase
ref|ZP_04829034.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   glycyl-tRNA synthetase
ref|ZP_04838149.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   glycyl-tRNA synthetase
ref|ZP_04866383.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   glycyl-tRNA synthetase
ref|ZP_04867350.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   glycyl-tRNA synthetase
ref|ZP_05144952.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   glycyl-tRNA synthetase
ref|ZP_05602114.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   glycyl-tRNA synthetase
ref|ZP_05604749.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   glycyl-tRNA synthetase
ref|ZP_05607368.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   glycyl-tRNA synthetase
ref|ZP_05610034.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   glycyl-tRNA synthetase
ref|ZP_05612634.1 Staphylococcus aureus subsp. aureus M876 RefSeq   glycyl-tRNA synthetase
ref|ZP_05642620.1 Staphylococcus aureus A9781 RefSeq   glycyl-tRNA synthetase
ref|ZP_05681339.1 Staphylococcus aureus A9763 RefSeq   glycyl-tRNA synthetase
ref|ZP_05683092.1 Staphylococcus aureus A9719 RefSeq   glycyl-tRNA synthetase
ref|ZP_05689381.1 Staphylococcus aureus A9299 RefSeq   glycyl-tRNA synthetase
ref|ZP_05691942.1 Staphylococcus aureus A8115 RefSeq   glycyl-tRNA synthetase
ref|ZP_05694964.1 Staphylococcus aureus A6300 RefSeq   glycyl-tRNA synthetase
ref|ZP_05696836.1 Staphylococcus aureus A6224 RefSeq   glycyl-tRNA synthetase
ref|ZP_05698668.1 Staphylococcus aureus A5948 RefSeq   glycyl-tRNA synthetase
ref|ZP_05701519.1 Staphylococcus aureus A5937 RefSeq   glycyl-tRNA synthetase
sp|A5IT93 Staphylococcus aureus (strain JH9) SwissProt   Glycyl-tRNA synthetase
sp|A6QHA8 Staphylococcus aureus (strain Newman) SwissProt   Glycyl-tRNA synthetase
sp|A6U237 Staphylococcus aureus (strain JH1) SwissProt   Glycyl-tRNA synthetase
sp|A7X2W2 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Glycyl-tRNA synthetase
sp|A8Z4A4 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Glycyl-tRNA synthetase
sp|P67034 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Glycyl-tRNA synthetase
sp|P67035 Staphylococcus aureus (strain MW2) SwissProt   Glycyl-tRNA synthetase
sp|P99129 Staphylococcus aureus (strain N315) SwissProt   Glycyl-tRNA synthetase
sp|Q2FGF8 Staphylococcus aureus (strain USA300) SwissProt   Glycyl-tRNA synthetase
sp|Q2FY08 Staphylococcus aureus (strain NCTC 8325) SwissProt   Glycyl-tRNA synthetase
sp|Q5HFJ5 Staphylococcus aureus (strain COL) SwissProt   Glycyl-tRNA synthetase
sp|Q6G902 Staphylococcus aureus (strain MSSA476) SwissProt   Glycyl-tRNA synthetase
sp|Q6GGD5 Staphylococcus aureus (strain MRSA252) SwissProt   Glycyl-tRNA synthetase
sp|SYG_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
sp|SYG_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Glycyl-tRNA synthetase; AltName: Full=Glycine--tRNA ligase; Short=GlyRS
tr|C2K6Q4 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Glycyl-tRNA synthetase
tr|C5N5Z1 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Glycyl-tRNA synthetase
tr|C5PZN2 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Glycyl-tRNA synthetase
tr|C5QJR8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Glycyl-tRNA synthetase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|426430.8.peg.1598 GTP-binding protein Era
7 fig|426430.8.peg.1601 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search