The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1553: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
Translate Function Assignments



Context on contig NC_009641 from base 1593706 to 1604977 (11272 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1549 1594698 1593706 993 -       3: 8 3 4   Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4) locus|NWMN_1423, protein_id|YP_001332457.1, gi|151221635, geneID|5330847
1550 1596135 1594714 1422 - 15     3: 8 3 4   Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4) gene_name|lpdA, locus|NWMN_1424, protein_id|YP_001332458.1, gi|151221636, geneID|5330848
1551 1597965 1596286 1680 - 150     2: 1 19   DNA repair protein RecN gene_name|recN, locus|NWMN_1425, protein_id|YP_001332459.1, gi|151221637, geneID|5332089
1552 1598433 1597981 453 - 15     1: 21   Arginine pathway regulatory protein ArgR, repressor of arg regulon gene_name|ahrC, locus|NWMN_1426, protein_id|YP_001332460.1, gi|151221638, geneID|5332342
1553 1599746 1598865 882 - 431     7: 14 17 9 10 12 20 13   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29) gene_name|ispA, locus|NWMN_1427, protein_id|YP_001332461.1, gi|151221639, geneID|5331725
1554 1599954 1599724 231 - -23     1: 1   Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)  
1555 1601284 1599947 1338 - -8     1: 1   Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) gene_name|xseA, locus|NWMN_1428, protein_id|YP_001332462.1, gi|151221640, geneID|5332058
1556 1601690 1601301 390 - 16     2: 11 7   Transcription termination protein NusB gene_name|nusB, locus|NWMN_1429, protein_id|YP_001332463.1, gi|151221641, geneID|5330849
1557 1602112 1601750 363 - 59         FIG01107926: hypothetical protein locus|NWMN_1430, protein_id|YP_001332464.1, gi|151221642, geneID|5332214
1558 1603482 1602127 1356 - 14     4: 5 2 6 15   Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) gene_name|accC, locus|NWMN_1431, protein_id|YP_001332465.1, gi|151221643, geneID|5330850
1559 1603946 1603482 465 - -1     4: 16 5 2 6   Biotin carboxyl carrier protein of acetyl-CoA carboxylase gene_name|accB, locus|NWMN_1432, protein_id|YP_001332466.1, gi|151221644, geneID|5331708
1560 1604977 1604420 558 - 473     2: 18 7   Translation elongation factor P gene_name|efp, locus|NWMN_1433, protein_id|YP_001332467.1, gi|151221645, geneID|5331706

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Archaeal_lipids gjo (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
Isoprenoid_Biosynthesis:_Interconversions RossO (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
Isoprenoid_Biosynthesis OlgaZ (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
archaeal_lipids_bobik (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
Polyprenyl_Diphosphate_Biosynthesis OlgaZ (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
Isoprenoid_Biosynthesis_PanGenomes Ravcheev_Dmitry_user Dimethylallyltransferase (EC 2.5.1.1)
Isoprenoid_Biosynthesis_PanGenomes Ravcheev_Dmitry_user (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)
Isoprenoid_Biosynthesis_PanGenomes Ravcheev_Dmitry_user Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
Isoprenoid_Biosynthesis_PanGenomes Ravcheev_Dmitry_user Octaprenyl diphosphate synthase (EC 2.5.1.90)
Carotenoids OlgaV (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10)


  Protein Sequence

>fig|426430.8.peg.1553 Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH

MD5 = 3c50981b541904d20fc1bb96da627689


  DNA Sequence

>fig|426430.8.peg.1553 Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
atgacgaatctaccgatgaataaattaatagatgaagtcaataatgaattatcggttgcg
ataaataaatcagtaatggatactcagctagaagaaagtatgttgtattcattaaatgct
ggaggtaaacgcatccgaccagttctgttattactcactttagattcactaaataccgag
tatgagttaggtatgaagagcgcaattgcactagaaatgattcatacatattcacttatt
catgatgacctaccagcgatggataatgatgattatcgacgaggaaaattaacaaatcat
aaagtatatggtgagtggactgcgatattagcaggtgatgctttattaactaaagcattt
gaacttatttcaagtgatgatagattaactgatgaagtaaaaataaaagttctacaacgg
ctgtcaatagcaagtggtcatgttggaatggtcggcggtcaaatgttagatatgcaaagc
gaaggccaaccaattgatcttgaaactttggaaatgatacacaaaacaaaaacaggagca
ttattaacttttgcggttatgagtgcagcagatatcgctaatgtcgatgatacaactaaa
gaacatttagaaagttatagttatcatttaggtatgatgttccagattaaagatgattta
ttagactgctatggtgatgaagcaaagttaggtaaaaaagtgggcagcgatcttgaaaat
aataaaagtacgtacgtgagtttattagggaaagatggcgcagaagataaattgacttat
catagagacgcagcagtggatgaactaacgcaaattgatgaacaattcaatacaaaacac
ttattagaaatcgttgatttattttatagcagggatcactaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1553 Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
aaagcattactaagtagtgttaatcaagaacaacaaaataatcttcaattgacaaaccaa
cttgttaaattattgaattctaagatattaagttataaaaatgatttgaaaaataaagta
gaaaacttaaacaatttaagtccaactaatacaatgttgcgtggatatgcaattgttaat
aaaaaagacgaagtcattacgagtactaaagatttaacagaaaatgatcaattgacgtta
acaatgaaagatggcttagtagatgcaaaagttacgaaagtaaggtgtaataatgactaa
agaaacgcaaagttttgaagaaatgatgcaagaattagagcaaattgttcaaaaattaga
taatgaaacagtatctttagaggaatcattagatttatatcaacgtggtatgaaactatc
agcagcttgtgacacaactttaaaaaatgccgaaaaaaaggtgaatgacttaataaaaga
agaagctgaggatgtaaaaaatgacgaatctaccgatgaataaattaatagatgaagtca
ataatgaattatcggttgcgataaataaatcagtaatggatactcagctagaagaaagta
tgttgtattcattaaatgctggaggtaaacgcatccgaccagttctgttattactcactt
tagattcactaaataccgagtatgagttaggtatgaagagcgcaattgcactagaaatga
ttcatacatattcacttattcatgatgacctaccagcgatggataatgatgattatcgac
gaggaaaattaacaaatcataaagtatatggtgagtggactgcgatattagcaggtgatg
ctttattaactaaagcatttgaacttatttcaagtgatgatagattaactgatgaagtaa
aaataaaagttctacaacggctgtcaatagcaagtggtcatgttggaatggtcggcggtc
aaatgttagatatgcaaagcgaaggccaaccaattgatcttgaaactttggaaatgatac
acaaaacaaaaacaggagcattattaacttttgcggttatgagtgcagcagatatcgcta
atgtcgatgatacaactaaagaacatttagaaagttatagttatcatttaggtatgatgt
tccagattaaagatgatttattagactgctatggtgatgaagcaaagttaggtaaaaaag
tgggcagcgatcttgaaaataataaaagtacgtacgtgagtttattagggaaagatggcg
cagaagataaattgacttatcatagagacgcagcagtggatgaactaacgcaaattgatg
aacaattcaatacaaaacacttattagaaatcgttgatttattttatagcagggatcact
aaaagcaaatatatcgattagcaacaattgtaaagtttgaaatgtctcaaaaggcatatt
caactgacgttgtttgttaatcgatttttctcatgttgaaacttaaaattatgttgaaga
ctttcatttaaaaaatagaattttcaatttctatacgacaatattcgtatctgtgatatc
aatgtgattttaattaaatatgttcaaacaattgacgcttattaaatctaataattagca
agtttattacacatatattcatttttatacatattttaagcaattgttatgcgtaatatg
aaaaatatttataaatagataaccaagatagataaaccatgtttaccctttttacgtaaa
ggtgtttagtagtcgtaaatcagtgcatgtgttaaaataaatgtataaatattcgtaatc
agaggtgtttactgtgcccaaaaaatcggttaggcatataaaaattagagaaattatttc
aaatgaacagatagagacacaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004337       F:geranyltranstransferase activity
GO:0008299       P:isoprenoid biosynthetic process
GO:0016740       F:transferase activity
cmr|NT05SA1441 Staphylococcus aureus NCTC 8325     geranyltranstransferase
cmr|SACOL1566 Staphylococcus aureus subsp. aureus COL     geranyltranstransferase
cmr|SAUSA300_1470 Staphylococcus aureus subsp. aureus USA300-FPR3757     geranyltranstransferase
dbj|BAF67699.1 Staphylococcus aureus subsp. aureus str. Newman     geranyltranstransferase
fig|367830.3.peg.2311 Staphylococcus aureus subsp. aureus USA300 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|426430.6.peg.1386 Staphylococcus aureus subsp. aureus str. Newman FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|451515.3.peg.1608 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|451516.9.peg.1613 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|452948.4.peg.255 Staphylococcus aureus 930918-3 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|455227.3.peg.1108 Staphylococcus aureus D30 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|546342.3.peg.810 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|546343.3.peg.62 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|553567.3.peg.665 Staphylococcus aureus A5948 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|553590.4.peg.610 Staphylococcus aureus A9754 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|553594.3.peg.1960 Staphylococcus aureus A9765 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|644279.4.peg.1673 Staphylococcus aureus subsp. aureus 132 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|93061.3.peg.1524 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|93061.5.peg.1472 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|93062.19.peg.1523 Staphylococcus aureus subsp. aureus COL FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
fig|93062.4.peg.1799 Staphylococcus aureus subsp. aureus COL FIG   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
gb|AAW36758.1 Staphylococcus aureus subsp. aureus COL     geranyltranstransferase
gb|ABD21052.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     geranyltranstransferase
gb|ABD30696.1 Staphylococcus aureus subsp. aureus NCTC 8325     geranyltranstransferase, putative
gb|ABX29530.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     geranyltranstransferase
gb|EEV84047.1 Staphylococcus aureus A5948     geranyltranstransferase
gb|EEW45845.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1619
gb|EEW47341.1 Staphylococcus aureus D30     hypothetical protein SAD30_0264
gi|150374439 Staphylococcus aureus subsp. aureus str. Newman NCBI   geranyltranstransferase
gi|151221639 Staphylococcus aureus subsp. aureus str. Newman NCBI   geranyltranstransferase
gi|160368559 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   geranyltranstransferase
gi|161509750 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   geranyltranstransferase
gi|221137831 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   geranyltranstransferase
gi|221140058 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   geranyltranstransferase
gi|257861234 Staphylococcus aureus A5948 NCBI   geranyltranstransferase
gi|258451179 Staphylococcus aureus A5948 NCBI   geranyltranstransferase
gi|259160825 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1619
gi|259162776 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0264
gi|57284664 Staphylococcus aureus subsp. aureus COL NCBI   geranyltranstransferase
gi|57650478 Staphylococcus aureus subsp. aureus COL NCBI   geranyltranstransferase
gi|87126538 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   geranyltranstransferase
gi|87160564 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   geranyltranstransferase
gi|87202886 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   geranyltranstransferase, putative
gi|88195328 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   geranyltranstransferase, putative
img|637152307 Staphylococcus aureus aureus COL IMG   geranyltranstransferase( EC:2.5.1.10 )
img|637888121 Staphylococcus aureus aureus USA300 IMG   geranyltranstransferase( EC:2.5.1.10 )
img|637894226 Staphylococcus aureus aureus NCTC 8325 IMG   geranyltranstransferase, putative( EC:2.5.1.10 )
img|640795808 Staphylococcus aureus aureus Newman IMG   geranyltranstransferase
img|641309482 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   geranyltranstransferase( EC:2.5.1.10 )
img|641770883 Staphylococcus aureus aureus USA300_TCH959 IMG   geranyltranstransferase
kegg|saa:SAUSA300_1470 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   geranyltranstransferase (EC:2.5.1.10)
kegg|sac:SACOL1566 Staphylococcus aureus subsp. aureus COL KEGG   geranyltranstransferase (EC:2.5.1.10)
kegg|sae:NWMN_1427 Staphylococcus aureus subsp. aureus Newman KEGG   geranyltranstransferase
kegg|sao:SAOUHSC_01618 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   geranyltranstransferase, putative (EC:2.5.1.10)
kegg|sax:USA300HOU_1523 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   geranyltranstransferase (EC:2.5.1.10)
ref|YP_001332461.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   geranyltranstransferase
ref|YP_001575409.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   geranyltranstransferase
ref|YP_186407.1 Staphylococcus aureus subsp. aureus COL RefSeq   geranyltranstransferase
ref|YP_494166.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   geranyltranstransferase
ref|YP_500132.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   geranyltranstransferase, putative
ref|ZP_03562633.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   geranyltranstransferase
ref|ZP_03564551.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   geranyltranstransferase
ref|ZP_05699214.1 Staphylococcus aureus A5948 RefSeq   geranyltranstransferase
tr|A6QH67 Staphylococcus aureus (strain Newman) TrEMBL   Geranyltranstransferase
tr|A8Z2F5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Geranyltranstransferase
tr|Q2FGL2 Staphylococcus aureus (strain USA300) TrEMBL   Geranyltranstransferase
tr|Q2FY48 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Geranyltranstransferase, putative
tr|Q5HFQ0 Staphylococcus aureus (strain COL) TrEMBL   Geranyltranstransferase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search