The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1526: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Segregation and condensation protein B
Translate Function Assignments



Context on contig NC_009641 from base 1565203 to 1578051 (12849 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1521 1567365 1565203 2163 -           hypothetical protein within a prophage locus|NWMN_1397, protein_id|YP_001332431.1, gi|151221609, geneID|5330828
1522 1568227 1567358 870 - -8         FIG01107889: hypothetical protein locus|NWMN_1398, protein_id|YP_001332432.1, gi|151221610, geneID|5330829
1523 1570226 1568532 1695 - 304     2: 4 11   Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) gene_name|srrB, locus|NWMN_1399, protein_id|YP_001332433.1, gi|151221611, geneID|5330830
1524 1570989 1570264 726 - 37       dlit(15060046)
dlit(17384184)
DNA-binding response regulator ResD gene_name|srrA, locus|NWMN_1400, protein_id|YP_001332434.1, gi|151221612, geneID|5332504
1525 1571859 1571122 738 - 132     2: 2 1   LSU rRNA pseudouridine(2605) synthase (EC 5.4.99.22) ## RluB gene_name|rluB, locus|NWMN_1401, protein_id|YP_001332435.1, gi|151221613, geneID|5332503
1526 1572394 1571852 543 - -8     2: 2 1   Segregation and condensation protein B locus|NWMN_1402, protein_id|YP_001332436.1, gi|151221614, geneID|5332359
1527 1573118 1572387 732 - -8     2: 2 1   Segregation and condensation protein A locus|NWMN_1403, protein_id|YP_001332437.1, gi|151221615, geneID|5330831
1528 1573210 1573716 507 + 91         DUF309 domain-containing protein locus|NWMN_1404, protein_id|YP_001332438.1, gi|151221616, geneID|5330832
1529 1574681 1573794 888 - 77       dlit(10939248) Site-specific tyrosine recombinase XerD locus|NWMN_1405, protein_id|YP_001332439.1, gi|151221617, geneID|5330833
1530 1575179 1574730 450 - 48     3: 7 10 5   Ferric uptake regulation protein FUR locus|NWMN_1406, protein_id|YP_001332440.1, gi|151221618, geneID|5330834
1531 1575826 1575284 543 - 104     6: 13 8 12 3 9 6   ADP-ribose pyrophosphatase (EC 3.6.1.13) locus|NWMN_1407, protein_id|YP_001332441.1, gi|151221619, geneID|5330835
1532 1575908 1576816 909 + 81         Oxidoreductase, aldo/keto reductase family protein locus|NWMN_1408, protein_id|YP_001332442.1, gi|151221620, geneID|5330836
1533 1577280 1577032 249 - 215         FIG01108613: hypothetical protein  
1534 1578051 1577296 756 - 15         Uncharacterized oxidoreductase YqjQ locus|NWMN_1409, protein_id|YP_001332443.1, gi|151221621, geneID|5330837

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Two_cell_division_clusters_relating_to_chromosome_partitioning RossO Segregation and condensation protein B
CBSS-314276.3.peg.1499 margovan Segregation and condensation protein B


  Protein Sequence

>fig|426430.8.peg.1526 Segregation and condensation protein B
MDNHGILESLLFTAGDEGLDEKQLLEILDMSKDQLVELIENYSSHGLMIQRFGMTYVLTT
KKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAK
GLVEAKVVNEQRSQQLITTDLFLNVFGISNIEDLPTTEEDDEEMDAFFSNLVNQKGENND

MD5 = e34e6b50f2c877b28c031978ba4c7a39


  DNA Sequence

>fig|426430.8.peg.1526 Segregation and condensation protein B
ttggataatcatggtatattagagtcgcttttatttacagctggcgatgaaggtttagat
gaaaaacaactattagaaatattagatatgtcgaaagaccaactcgttgaattaattgaa
aattattcatcacatggattaatgatacaacgatttggaatgacgtatgttttaacgact
aaaaaagaagcggcaacgtatattgaacaattaattgaacaaaagtcacaaatgaaatta
tcacaagcagcaatggaagtactatcaattattgcttataaccagccattatcaagaagt
gatattgaattaattcgtagtatcaattcagatggtgcagttaagacattgattgccaaa
ggactagttgaggctaaagtggttaatgaacagcgtagccaacagttaattactactgat
ttatttttaaatgtatttggtatttccaatatagaagatttgccgacaactgaagaagac
gatgaagaaatggatgcttttttcagtaatctagtcaatcaaaaaggagaaaataatgac
taa


  DNA with Flanking Sequence

>fig|426430.8.peg.1526 Segregation and condensation protein B
atcaacatcagatatggatgttgatgatgacccacgggaagatttagttgggcgtttaat
agaatatcaaaattataaagaatatactgctattttaaatgacatgaaagaagaaagaga
tttttattttacaaaaagaccgacagatttatctcatttggaaacagatgaatcttggga
tccaaatcatacgattgatttaactgaattaattgtagcttatcaaagagttaaaaatag
agttgagttaaatacacctaaatctgttgaaatccgaaaagagacatttaccattcaaca
agctacagaacaagtgacatcgagattgaaagataaagatcattttaacttctttagtct
gtttacgttttctgagccaattgaacaagtagtcactcactttttagctattttagagat
gtcaaaagcaggaataattaatattgagcaacaacgtaattttgaagatattaacattat
tagaggagtgaactaccattttggataatcatggtatattagagtcgcttttatttacag
ctggcgatgaaggtttagatgaaaaacaactattagaaatattagatatgtcgaaagacc
aactcgttgaattaattgaaaattattcatcacatggattaatgatacaacgatttggaa
tgacgtatgttttaacgactaaaaaagaagcggcaacgtatattgaacaattaattgaac
aaaagtcacaaatgaaattatcacaagcagcaatggaagtactatcaattattgcttata
accagccattatcaagaagtgatattgaattaattcgtagtatcaattcagatggtgcag
ttaagacattgattgccaaaggactagttgaggctaaagtggttaatgaacagcgtagcc
aacagttaattactactgatttatttttaaatgtatttggtatttccaatatagaagatt
tgccgacaactgaagaagacgatgaagaaatggatgcttttttcagtaatctagtcaatc
aaaaaggagaaaataatgactaaagaattagaacgattacaaaaacgtatagctaatagc
ggttatacttcaagacgtaaggcagaaactttaatttctgaaggaaaagtgaaagtgaat
ggtacgactgtcactgaattaggaacaaaagtgaagccatcagatacgattgaagttgaa
ggtattaaaatagaactagaagacaaaatttacattttattccataaaccaactcaagtg
ataacaagtgtatctgatgatagaggacgtacagtggttacagattactttaaagatata
gaagcacgtatttatcctgttggtcgtttagactatgatacttctggattgttattactc
acaaatgatggtgaatttactaatttaatgacacatccaagatatcaaattaagaaaaaa
tatgttgcgaaattaaaaggttatttaatgagagaagaagtgaaagcgctagaaaaaggt
attgaattagaagatggtatgacgcaaccggctgaagtgaaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005737       C:cytoplasm
GO:0006260       P:DNA replication
GO:0007049       P:cell cycle
GO:0007059       P:chromosome segregation
GO:0051301       P:cell division
cmr|NT05SA1413 Staphylococcus aureus NCTC 8325     segregation and condensation protein B
cmr|SACOL1537 Staphylococcus aureus subsp. aureus COL     segregation and condensation protein B
cmr|SAUSA300_1444 Staphylococcus aureus subsp. aureus USA300-FPR3757     segregation and condensation protein B
dbj|BAF67674.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2108 Staphylococcus aureus subsp. aureus USA300 FIG   Segregation and condensation protein B
fig|426430.6.peg.1361 Staphylococcus aureus subsp. aureus str. Newman FIG   Segregation and condensation protein B
fig|451515.3.peg.1581 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Segregation and condensation protein B
fig|451516.9.peg.1586 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Segregation and condensation protein B
fig|452948.4.peg.2654 Staphylococcus aureus 930918-3 FIG   Segregation and condensation protein B
fig|455227.3.peg.1081 Staphylococcus aureus D30 FIG   Segregation and condensation protein B
fig|546342.3.peg.783 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Segregation and condensation protein B
fig|546343.3.peg.90 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Segregation and condensation protein B
fig|553567.3.peg.638 Staphylococcus aureus A5948 FIG   Segregation and condensation protein B
fig|553590.4.peg.583 Staphylococcus aureus A9754 FIG   Segregation and condensation protein B
fig|553594.3.peg.1933 Staphylococcus aureus A9765 FIG   Segregation and condensation protein B
fig|644279.4.peg.1647 Staphylococcus aureus subsp. aureus 132 FIG   Segregation and condensation protein B
fig|93061.3.peg.1495 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Segregation and condensation protein B
fig|93061.5.peg.1445 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Segregation and condensation protein B
fig|93062.19.peg.1497 Staphylococcus aureus subsp. aureus COL FIG   Segregation and condensation protein B
fig|93062.4.peg.1771 Staphylococcus aureus subsp. aureus COL FIG   Segregation and condensation protein B
gb|AAW36730.1 Staphylococcus aureus subsp. aureus COL     segregation and condensation protein B
gb|ABD20571.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     segregation and condensation protein B
gb|ABD30667.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EEV84020.1 Staphylococcus aureus A5948     segregation and condensation protein B
gb|EEW47315.1 Staphylococcus aureus D30     hypothetical protein SAD30_0238
gi|122539459 organism not parsed/found in ncbi nr NCBI   RecName: Full=Segregation and condensation protein B
gi|123485741 organism not parsed/found in ncbi nr NCBI   RecName: Full=Segregation and condensation protein B
gi|150374414 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221614 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1402
gi|172048895 organism not parsed/found in ncbi nr NCBI   RecName: Full=Segregation and condensation protein B
gi|221137804 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_03968
gi|221140085 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_00445
gi|257861207 Staphylococcus aureus A5948 NCBI   segregation and condensation protein B
gi|258451152 Staphylococcus aureus A5948 NCBI   segregation and condensation protein B
gi|259162750 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0238
gi|57284636 Staphylococcus aureus subsp. aureus COL NCBI   segregation and condensation protein B
gi|57650450 Staphylococcus aureus subsp. aureus COL NCBI   segregation and condensation protein B
gi|81694452 organism not parsed/found in ncbi nr NCBI   RecName: Full=Segregation and condensation protein B
gi|87126057 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   segregation and condensation protein B
gi|87160083 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   segregation and condensation protein B
gi|87202857 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195299 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01588
img|637152279 Staphylococcus aureus aureus COL IMG   segregation and condensation protein B
img|637888095 Staphylococcus aureus aureus USA300 IMG   segregation and condensation protein B
img|637894197 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795783 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641770854 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1444 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   segregation and condensation protein B
kegg|sac:SACOL1537 Staphylococcus aureus subsp. aureus COL KEGG   segregation and condensation protein B
kegg|sae:NWMN_1402 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_01588 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_001332436.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1402
ref|YP_186379.1 Staphylococcus aureus subsp. aureus COL RefSeq   segregation and condensation protein B
ref|YP_494140.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   segregation and condensation protein B
ref|YP_500103.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01588
ref|ZP_03562606.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_03968
ref|ZP_03564578.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_00445
ref|ZP_05699187.1 Staphylococcus aureus A5948 RefSeq   segregation and condensation protein B
sp|A6QH42 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=Segregation and condensation protein B
sp|Q2FGN8 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Segregation and condensation protein B
sp|Q2FY77 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Segregation and condensation protein B
sp|Q5HFS8 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Segregation and condensation protein B
sp|SCPB_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Segregation and condensation protein B
sp|SCPB_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Segregation and condensation protein B
sp|SCPB_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Segregation and condensation protein B
sp|SCPB_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Segregation and condensation protein B


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search