The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1522: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01107889: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 1562071 to 1573716 (11646 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1517 1562985 1562071 915 -           FIG01107889: hypothetical protein locus|NWMN_1394, protein_id|YP_001332428.1, gi|151221606, geneID|5330825
1518 1563206 1563000 207 - 14         FIG01109037: hypothetical protein  
1519 1564137 1563199 939 - -8         FIG01107889: hypothetical protein locus|NWMN_1395, protein_id|YP_001332429.1, gi|151221607, geneID|5330826
1520 1565112 1564195 918 - 57         FIG01107889: hypothetical protein locus|NWMN_1396, protein_id|YP_001332430.1, gi|151221608, geneID|5330827
1521 1567365 1565203 2163 - 90         hypothetical protein within a prophage locus|NWMN_1397, protein_id|YP_001332431.1, gi|151221609, geneID|5330828
1522 1568227 1567358 870 - -8         FIG01107889: hypothetical protein locus|NWMN_1398, protein_id|YP_001332432.1, gi|151221610, geneID|5330829
1523 1570226 1568532 1695 - 304     2: 3 4   Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) gene_name|srrB, locus|NWMN_1399, protein_id|YP_001332433.1, gi|151221611, geneID|5330830
1524 1570989 1570264 726 - 37       dlit(15060046)
dlit(17384184)
DNA-binding response regulator ResD gene_name|srrA, locus|NWMN_1400, protein_id|YP_001332434.1, gi|151221612, geneID|5332504
1525 1571859 1571122 738 - 132     2: 2 1   LSU rRNA pseudouridine(2605) synthase (EC 5.4.99.22) ## RluB gene_name|rluB, locus|NWMN_1401, protein_id|YP_001332435.1, gi|151221613, geneID|5332503
1526 1572394 1571852 543 - -8     2: 2 1   Segregation and condensation protein B locus|NWMN_1402, protein_id|YP_001332436.1, gi|151221614, geneID|5332359
1527 1573118 1572387 732 - -8     2: 2 1   Segregation and condensation protein A locus|NWMN_1403, protein_id|YP_001332437.1, gi|151221615, geneID|5330831
1528 1573210 1573716 507 + 91         DUF309 domain-containing protein locus|NWMN_1404, protein_id|YP_001332438.1, gi|151221616, geneID|5330832

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1522 FIG01107889: hypothetical protein
MENESKKDTKTETKSVPEEMEASKYVGQGFQPPAEKNAIEFAKKHRKEFEKVGEQFFKDN
FGLKVKATNVVGKDDGVEVYVHCEDHGIVFNASLPLYKDAIHQKGSMRSNDNGDDMSMMV
GTVLSGFEYRAQKEKYDNLYKFFKENEKKYQYTGFTKEAINKTQNVGYKNEYFYITYSSR
SLKEYRKYYEPLIRKNDKEFKEGMERARKEVNYAANTDAVATLFSTKKNFTKDNTVDDVI
ELSDKLYNLKNKPDKSTITIQIGKPTINTKKAFYDDNRPIEYGVHSKDE

MD5 = d98d4f26fb0dd7279d83b8e95cac5295


  DNA Sequence

>fig|426430.8.peg.1522 FIG01107889: hypothetical protein
atggaaaatgaatcaaaaaaagacacaaaaacagaaacaaaatctgtaccagaagaaatg
gaagcttcaaaatatgtaggccaaggcttccaaccgcctgcagaaaaaaatgcgattgaa
tttgcgaagaagcatcgtaaagaatttgaaaaagtaggtgaacaattctttaaagataac
tttggactaaaagttaaagctacaaatgttgtaggtaaagatgatggtgtagaagtttat
gtgcattgtgaagatcatggcattgtatttaatgcaagtctacctttgtacaaagatgcc
atccatcaaaaaggatcaatgcgcagtaatgacaatggtgatgatatgagtatgatggtg
ggtacagtgctgagtggctttgaatatcgagcgcaaaaagaaaagtatgataacttatat
aaattcttcaaagaaaatgaaaagaaatatcaatatacaggctttacaaaagaggcaatt
aacaagacacaaaatgtcggatataaaaatgaatatttttatattacatactcttctaga
agtttaaaagaatatcgaaagtattatgaaccactgattcgaaaaaatgataaagaattt
aaagaaggaatggaacgagcaagaaaagaagtgaattacgctgcaaatacagatgctgtt
gctacacttttttctactaagaaaaactttactaaagacaatacagtagatgatgtaatc
gaactaagtgataaattatataatttaaaaaataaaccagataaatctacaatcacaata
caaatagggaaacccactattaatactaagaaagccttttatgatgataatcgtccaata
gaatatggggtgcacagtaaagatgaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1522 FIG01107889: hypothetical protein
tgcaccagaacatttacaacaagtatttgatcgtttttataaagttgatgcagcgagaac
gcgaggtaaacaaggtaccggtttaggtttgttcatttgtaaaatgattatcgaagagca
tggtggttccatagatgttaaaagcgaattagggaaaggcacaacatttattattaaact
accaaaaccagaataaaattgaatatagttatttcagaacgcatgttattgattagagac
tctaatttatagcatgcgttttttgattgatgtggggaattttgtatgtggattagaact
tagggtttttgcgaatatcaactattaaatatattactaatttatacaaaaatataaagt
ttgataaagttatttatttgattataaaaatagggtaaaatatagatatattgtattaat
taaattattcgaggtgtcatatgaaaaaattcattggatcagttttagctacgacattaa
ttttagggggatgttccacgatggaaaatgaatcaaaaaaagacacaaaaacagaaacaa
aatctgtaccagaagaaatggaagcttcaaaatatgtaggccaaggcttccaaccgcctg
cagaaaaaaatgcgattgaatttgcgaagaagcatcgtaaagaatttgaaaaagtaggtg
aacaattctttaaagataactttggactaaaagttaaagctacaaatgttgtaggtaaag
atgatggtgtagaagtttatgtgcattgtgaagatcatggcattgtatttaatgcaagtc
tacctttgtacaaagatgccatccatcaaaaaggatcaatgcgcagtaatgacaatggtg
atgatatgagtatgatggtgggtacagtgctgagtggctttgaatatcgagcgcaaaaag
aaaagtatgataacttatataaattcttcaaagaaaatgaaaagaaatatcaatatacag
gctttacaaaagaggcaattaacaagacacaaaatgtcggatataaaaatgaatattttt
atattacatactcttctagaagtttaaaagaatatcgaaagtattatgaaccactgattc
gaaaaaatgataaagaatttaaagaaggaatggaacgagcaagaaaagaagtgaattacg
ctgcaaatacagatgctgttgctacacttttttctactaagaaaaactttactaaagaca
atacagtagatgatgtaatcgaactaagtgataaattatataatttaaaaaataaaccag
ataaatctacaatcacaatacaaatagggaaacccactattaatactaagaaagcctttt
atgatgataatcgtccaatagaatatggggtgcacagtaaagatgaataaaattaatgat
agggatttaacagaattaagtagttactgggtttatcaaaatattgatataaaaaaagaa
tttaaagttaatggaaaaaggtttaaacaagtagacagttataatgatgataagaatagt
aatttgaatggtgctgctgatattaaaatatatgagttattagatgataaaagtaaacca
actggtcaacagacaataatttatcaaggaacatctaatgaggcaattaatccaaataat
ccattaaaatcatcggggtttggagatgattggctccaaaatgctaaattaatgaataat
gataatgaaagcacagattatttaaagcaaacagatcaattatcaaatcaatataaaata
aagttagaagatgcagatagattatcaaatagtgattttttaaaaaaatatagaatggaa
tcaagtaacttcaaaaacaaaaccattgtggcggatggcggtaattcggaaggcggtgca
ggagcaaaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SAUSA300_1440 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
fig|367830.3.peg.2104 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107889: hypothetical protein
fig|451515.3.peg.1577 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107889: hypothetical protein
fig|451516.9.peg.1582 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107889: hypothetical protein
fig|553590.4.peg.579 Staphylococcus aureus A9754 FIG   FIG01107889: hypothetical protein
fig|553594.3.peg.1929 Staphylococcus aureus A9765 FIG   FIG01107889: hypothetical protein
fig|93061.3.peg.1491 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107889: hypothetical protein
fig|93062.19.peg.1493 Staphylococcus aureus subsp. aureus COL FIG   FIG01107889: hypothetical protein
fig|93062.4.peg.1767 Staphylococcus aureus subsp. aureus COL FIG   FIG01107889: hypothetical protein
gb|ABD20788.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30663.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gi|57650446 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1533
gi|87126274 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160300 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1440
gi|87202853 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195295 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01584
img|637152275 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888091 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894193 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|saa:SAUSA300_1440 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1533 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sao:SAOUHSC_01584 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_186375.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1533
ref|YP_494136.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1440
ref|YP_500099.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01584
tr|Q2FGP2 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FY81 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search