The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1520: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: FIG01107889: hypothetical protein
Translate Function Assignments



Context on contig NC_009641 from base 1558145 to 1570226 (12082 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1512 1559524 1558145 1380 -       1: 6   ATP-dependent DNA helicase, RecQ family locus|NWMN_1390, protein_id|YP_001332424.1, gi|151221602, geneID|5331884
1513 1560467 1559514 954 - -11         hypothetical protein YpbB locus|NWMN_1391, protein_id|YP_001332425.1, gi|151221603, geneID|5330823
1514 1560575 1560823 249 + 107     1: 2   [4Fe-4S] ferredoxin gene_name|fer, locus|NWMN_1392, protein_id|YP_001332426.1, gi|151221604, geneID|5330824
1515 1561474 1560929 546 - 105     2: 4 3   Riboflavin ECF transporter, substrate-specific component RibU locus|NWMN_1393, protein_id|YP_001332427.1, gi|151221605, geneID|5331905
1516 1561872 1561753 120 - 278         FIG01109839: hypothetical protein  
1517 1562985 1562071 915 - 198         FIG01107889: hypothetical protein locus|NWMN_1394, protein_id|YP_001332428.1, gi|151221606, geneID|5330825
1518 1563206 1563000 207 - 14         FIG01109037: hypothetical protein  
1519 1564137 1563199 939 - -8         FIG01107889: hypothetical protein locus|NWMN_1395, protein_id|YP_001332429.1, gi|151221607, geneID|5330826
1520 1565112 1564195 918 - 57         FIG01107889: hypothetical protein locus|NWMN_1396, protein_id|YP_001332430.1, gi|151221608, geneID|5330827
1521 1567365 1565203 2163 - 90         hypothetical protein within a prophage locus|NWMN_1397, protein_id|YP_001332431.1, gi|151221609, geneID|5330828
1522 1568227 1567358 870 - -8         FIG01107889: hypothetical protein locus|NWMN_1398, protein_id|YP_001332432.1, gi|151221610, geneID|5330829
1523 1570226 1568532 1695 - 304     2: 1 5   Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) gene_name|srrB, locus|NWMN_1399, protein_id|YP_001332433.1, gi|151221611, geneID|5330830

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1520 FIG01107889: hypothetical protein
MFKRTKLILIATLLLSGCSTTNNESNKETKSVPEEMEASKYVGQGFQPPAEKDVVEFAKK
HKDKIAKRGEQFFMDNFGLKVKATNVVGSGKGVEVFVHCDDHDIVFNASIPFDKSIIESD
SSLRSEDKGDDMSTLVGTVLSGFEYRTQKEKYDNLYKFFKDNEEKYQYTGFTKEAINKTQ
NVGYKNEYFYITYSSRSLKEYRKYYEPLIHKNDKEFKEGMEQARKEVNYAANTDTVTTLF
STKENFTKDNTVDDVIELSDKLYNFKNKPEKSTITIQIGKPTINTKKAFYDDNDPIEYGV
YRKDE

MD5 = e638740fa04a11488fced052f5f765e3


  DNA Sequence

>fig|426430.8.peg.1520 FIG01107889: hypothetical protein
atgtttaaaagaactaaactaatcttaatagcaacattactgctatcaggatgttcaact
accaataacgaatctaataaagaaacaaaatcagtgccagaagaaatggaagcttcaaaa
tatgtaggtcaaggcttccaaccacctgcagaaaaagatgtggttgaatttgcgaaaaag
cataaagataaaattgccaaacgaggcgaacaattttttatggataatttcggtctaaaa
gttaaagctaccaatgttgtaggtagtggaaaaggcgtagaagtattcgtgcattgtgat
gaccacgatatcgtatttaatgcgagtattccatttgataaatcaataattgagagtgat
agctcattaagaagtgaggacaaaggcgatgatatgagtactttagttggtacagtgttg
agtggctttgaatatcgaacacaaaaagaaaagtatgacaatttatataaatttttcaaa
gataatgaagagaaataccaatatacaggctttacaaaagaagcaataaacaagacgcaa
aatgtcggatataaaaatgaatatttttatatcacttactcgtcaagaagcttaaaagaa
tatcgtaagtattacgaaccattgattcataaaaatgataaagaatttaaagaaggaatg
gaacaagccagaaaagaagtgaattacgctgctaatacagatacagtaacaacattgttt
agtacaaaggaaaattttactaaagacaatacagttgatgatgtaattgaactgagtgat
aaactatataattttaaaaataagccagaaaaatctacaattacaattcaaataggaaag
cctactattaatactaaaaaagccttttatgatgataatgatccaatagaatatggagtg
tatcgtaaagatgaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1520 FIG01107889: hypothetical protein
taaatgtaaaaaagaaagaatttttgtccctgattcctaatgtaacttgtaattatatta
aaactaaattagaagaattagataatactttaggcaaatgggagccttttcttaatgatt
taaaagcagtgtcaccaattttagataaccatttagatgatattgttaagaacatgaagc
ctttgattgtacaaatgatatttgaaccatcacattatgacgatatgtttattttaaaca
cacaagctcatgcgcgtcttgatcaaatggcacaacagtttgaagttgtttgtaatggct
tgaacgaaaatgaaggacaagcaattcaaacgatggatcaatctgcctctctaatacggt
caaacttaattcaagttaaagaacaattagaaaaactagctgtatactaattaatttatt
aaatgctacttgttttcattgagaataagtagctttttcaaacataaaagttttacaaac
acataaatgggtgatgagctatgtttaaaagaactaaactaatcttaatagcaacattac
tgctatcaggatgttcaactaccaataacgaatctaataaagaaacaaaatcagtgccag
aagaaatggaagcttcaaaatatgtaggtcaaggcttccaaccacctgcagaaaaagatg
tggttgaatttgcgaaaaagcataaagataaaattgccaaacgaggcgaacaatttttta
tggataatttcggtctaaaagttaaagctaccaatgttgtaggtagtggaaaaggcgtag
aagtattcgtgcattgtgatgaccacgatatcgtatttaatgcgagtattccatttgata
aatcaataattgagagtgatagctcattaagaagtgaggacaaaggcgatgatatgagta
ctttagttggtacagtgttgagtggctttgaatatcgaacacaaaaagaaaagtatgaca
atttatataaatttttcaaagataatgaagagaaataccaatatacaggctttacaaaag
aagcaataaacaagacgcaaaatgtcggatataaaaatgaatatttttatatcacttact
cgtcaagaagcttaaaagaatatcgtaagtattacgaaccattgattcataaaaatgata
aagaatttaaagaaggaatggaacaagccagaaaagaagtgaattacgctgctaatacag
atacagtaacaacattgtttagtacaaaggaaaattttactaaagacaatacagttgatg
atgtaattgaactgagtgataaactatataattttaaaaataagccagaaaaatctacaa
ttacaattcaaataggaaagcctactattaatactaaaaaagccttttatgatgataatg
atccaatagaatatggagtgtatcgtaaagatgaataaattttttttaaaatgcttttta
atattctatataaacacataaatgggtgatgagctatgtttaaaaaggcgaaattaatct
taatagcaacgctactgttatcaggatgttcagcgatgaataatgaatcaaaaaaagaca
caaatacagaaacaaatacagaaacaaaatcagtaccagaagaaatggaagcttcaaaat
atgtaggacaaggctttcaaccacctgcagaaaaagatgcgattgaatttgtgaagaagc
atcgtaaagaatttgaaaaagtaggtgaacaattctttaaagataactttggactaaaag
ttaaagctacaaatgttgtaggtaaagatgatggtgtagaagtttatgtgcattgcgaag
atcatggcattgtatttaatgcaagtctacctttgtacaaagatgccatccatcaaaaag
gatcaatgcgtagtaatgacaacggtgatgatatgagtatgatggtgggtacagtgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1344 Staphylococcus aureus NCTC 8325     lipoprotein, putative
cmr|SACOL1531 Staphylococcus aureus subsp. aureus COL     lipoprotein, putative
cmr|SAUSA300_1379 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative lipoprotein
dbj|BAF67668.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1886 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107889: hypothetical protein
fig|426430.6.peg.1355 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107889: hypothetical protein
fig|451515.3.peg.1509 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107889: hypothetical protein
fig|451516.9.peg.1514 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107889: hypothetical protein
fig|452948.4.peg.2769 Staphylococcus aureus 930918-3 FIG   FIG01107889: hypothetical protein
fig|455227.3.peg.2597 Staphylococcus aureus D30 FIG   FIG01107889: hypothetical protein
fig|546343.3.peg.2104 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107889: hypothetical protein
fig|553567.3.peg.632 Staphylococcus aureus A5948 FIG   FIG01107889: hypothetical protein
fig|553590.4.peg.510 Staphylococcus aureus A9754 FIG   FIG01107889: hypothetical protein
fig|553594.3.peg.768 Staphylococcus aureus A9765 FIG   FIG01107889: hypothetical protein
fig|644279.4.peg.1580 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107889: hypothetical protein
fig|93061.3.peg.1420 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107889: hypothetical protein
fig|93061.5.peg.1375 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107889: hypothetical protein
fig|93062.19.peg.1491 Staphylococcus aureus subsp. aureus COL FIG   FIG01107889: hypothetical protein
fig|93062.4.peg.1759 Staphylococcus aureus subsp. aureus COL FIG   FIG01107889: hypothetical protein
gb|AAW36724.1 Staphylococcus aureus subsp. aureus COL     lipoprotein, putative
gb|ABD22675.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative lipoprotein
gb|ABD30594.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29438.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     lipoprotein
gb|EEV84014.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150374408 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221608 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1396
gi|160368467 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lipoprotein
gi|161509658 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lipoprotein
gi|221142049 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   lipoprotein
gi|257861201 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451146 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57284630 Staphylococcus aureus subsp. aureus COL NCBI   lipoprotein, putative
gi|57650444 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1531
gi|87128161 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipoprotein
gi|87162187 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative lipoprotein
gi|87202784 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195226 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01512
img|637152273 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637888031 Staphylococcus aureus aureus USA300 IMG   putative lipoprotein
img|637894122 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795777 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309390 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   lipoprotein
kegg|saa:SAUSA300_1379 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative lipoprotein
kegg|sac:SACOL1531 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1396 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_01512 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1428 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   lipoprotein
ref|YP_001332430.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1396
ref|YP_001575317.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   lipoprotein
ref|YP_186373.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1531
ref|YP_494076.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative lipoprotein
ref|YP_500028.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01512
ref|ZP_03566542.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   lipoprotein
ref|ZP_05699181.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QH36 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z263 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Lipoprotein
tr|Q2FGV2 Staphylococcus aureus (strain USA300) TrEMBL   Putative lipoprotein
tr|Q2FYE2 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HFT4 Staphylococcus aureus (strain COL) TrEMBL   Lipoprotein, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search