The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|426430.8.peg.1491: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Putative membrane protease YugP
Translate Function Assignments


Context on contig NC_009641 from base 1530769 to 1544421 (13653 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
1486 1533462 1530769 2694 -       1: 16   DinG family ATP-dependent helicase YoaA locus|NWMN_1366, protein_id|YP_001332400.1, gi|151221578, geneID|5331760
1487 1534457 1533486 972 - 23     4: 8 18 9 13   Biotin--protein ligase (EC 6.3.4.9)(EC 6.3.4.10)(EC 6.3.4.11)(EC 6.3.4.15) / Biotin operon repressor gene_name|birA, locus|NWMN_1367, protein_id|YP_001332401.1, gi|151221579, geneID|5330812
1488 1535646 1534444 1203 - -14     2: 15 7   tRNA nucleotidyltransferase (EC 2.7.7.21) (EC 2.7.7.25) locus|NWMN_1368, protein_id|YP_001332402.1, gi|151221580, geneID|5331780
1489 1536763 1535651 1113 - 4 4 1: 11   Glycosyl transferase, group 1 family protein locus|NWMN_1369, protein_id|YP_001332403.1, gi|151221581, geneID|5330813
1490 1537351 1537034 318 - 270         Uncharacterized protein YpjD locus|NWMN_1370, protein_id|YP_001332404.1, gi|151221582, geneID|5330814
1491 1538386 1537688 699 - 336       Putative membrane protease YugP locus|NWMN_1371, protein_id|YP_001332405.1, gi|151221583, geneID|5330815
1492 1539027 1538440 588 - 53 4 1: 2   Hypothetical transmembrane protein CDS_ID OB1773 locus|NWMN_1372, protein_id|YP_001332406.1, gi|151221584, geneID|5330816
1493 1539592 1539017 576 - -11     1: 2   BH1670 unknown conserved protein in B. subtilis locus|NWMN_1373, protein_id|YP_001332407.1, gi|151221585, geneID|5330817
1494 1540850 1539606 1245 - 13     1: 2   TPR domain protein locus|NWMN_1374, protein_id|YP_001332408.1, gi|151221586, geneID|5330818
1495 1542155 1540857 1299 - 6     5: 4 5 3 6 1   5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) alpha sub-homology division gene_name|aroA, locus|NWMN_1375, protein_id|YP_001332409.1, gi|151221587, geneID|5330819
1496 1543229 1542165 1065 - 9     5: 14 5 17 3 1   3-dehydroquinate synthase (EC 4.2.3.4) gene_name|aroB, locus|NWMN_1376, protein_id|YP_001332410.1, gi|151221588, geneID|5331754
1497 1544421 1543255 1167 - 25     6: 12 4 10 3 6 1   Chorismate synthase (EC 4.2.3.5) gene_name|aroC, locus|NWMN_1377, protein_id|YP_001332411.1, gi|151221589, geneID|5331755

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1491 Putative membrane protease YugP
MSSIFTMIIYFVILMVLPLWAQHKVKSNYEKYSQVRSTSGKTGREVALEILHANGIYDVE
VVKGEGFLTDHYDPKKKVVSLSPANYDRPSVAGTAIAAHEVGHAIQDHQGYWFLRFRAAL
VPVANLGSSLSYMIIMLGIILTAIGSAFGSTALWIGAGLMSLAVLFSIVTLPVEFDASSR
AMKQITALNIVNEKEYKHARKVLSAAAMTYVAATAVAVAELVRIILIARSSD

MD5 = 98f7b8bd831694185213efc70e3e80dd


  DNA Sequence

>fig|426430.8.peg.1491 Putative membrane protease YugP
ttgtcttcaatttttactatgataatttatttcgtaatattaatggtgcttcctttatgg
gcacaacacaaagttaaatctaactatgagaaatattcacaagttagatcaactagtggt
aaaacgggtcgtgaagttgcattagaaattttacatgcaaacggtatttatgatgtcgaa
gttgttaaaggtgaaggattcttaacagatcattacgatcctaaaaagaaagttgtttca
ctatctcctgcaaactatgacagaccatcagttgctggaactgcaattgcagcccacgaa
gttggtcatgccattcaagatcaccaaggatattggttcttaagattcagagcagcatta
gtacctgttgcaaacctagggagttcattaagttatatgatcatcatgttaggtattatc
ttaacagcgataggtagtgcatttggttcaactgctttatggattggtgctggtttaatg
tcattagcggtattattctcaattgttacgttaccagttgagtttgatgcgagttcaaga
gcgatgaaacaaattacggcattgaacattgtaaatgaaaaagaatacaagcatgcgcgt
aaagtattatctgcagcagcaatgacttatgttgcagcaactgcagtcgctgtagcagag
cttgtacgtattattttgattgcgcgttcaagtgattaa


  DNA with Flanking Sequence

>fig|426430.8.peg.1491 Putative membrane protease YugP
atttttgttccagatagctcaactgcaatattatacttagttatttctatctcattgata
ttaattcaaaaacaaaatagtattatcgatgcactggcatttgtaacattattcaaatat
gggatttgggcagttataatgaatatattatttattattgaacaaggtgatattacagta
aatggtttggtattaatgttttcccacagtataatggctgttcaggcaatttacttctat
cctaggtttaaacgttctatgattggaatcagtgtagcgatgatttgggtgtttttgaat
gattatattgactattttcaccttcaatttccatattatgattttataactacacatgtg
tggcaaattggtgtattatcatgttgtctaagtgtttttggacttttgctttatattgaa
ttaaacaaattattaaagtgtaaatgatttgataaaaacggcaaatgacagtaaaatatt
tataaaggagagtgagtttattgtcttcaatttttactatgataatttatttcgtaatat
taatggtgcttcctttatgggcacaacacaaagttaaatctaactatgagaaatattcac
aagttagatcaactagtggtaaaacgggtcgtgaagttgcattagaaattttacatgcaa
acggtatttatgatgtcgaagttgttaaaggtgaaggattcttaacagatcattacgatc
ctaaaaagaaagttgtttcactatctcctgcaaactatgacagaccatcagttgctggaa
ctgcaattgcagcccacgaagttggtcatgccattcaagatcaccaaggatattggttct
taagattcagagcagcattagtacctgttgcaaacctagggagttcattaagttatatga
tcatcatgttaggtattatcttaacagcgataggtagtgcatttggttcaactgctttat
ggattggtgctggtttaatgtcattagcggtattattctcaattgttacgttaccagttg
agtttgatgcgagttcaagagcgatgaaacaaattacggcattgaacattgtaaatgaaa
aagaatacaagcatgcgcgtaaagtattatctgcagcagcaatgacttatgttgcagcaa
ctgcagtcgctgtagcagagcttgtacgtattattttgattgcgcgttcaagtgattaat
cttatagattaacaattaacttaaattagacacttattaactagctaatcacatttttgt
gtggttgctagtttttttgtgcttatttttctaatggtagattattcactatattatttt
attgtagtggtacgtatcataaagttataatcccaatttcaattgatttaatttagttag
gaatgcattacatttatataaactgaattattaaacttctaaaataaacaacttgtcatc
tagtttagctagagtcagtagattgcactaaacatgcatgagacttcaaattgatatata
ctatattagaaatgcaatataaggagaacgtagaaatgaaatcaatggtagaaatgcaac
gtgaagttgatgaatatattggacaatttaaaacaggatatttttcaccattagctaact
tagctagattgactgaagaagtgggcgaacttgcacgtgaaataaatcatacctatggtg
aaaaaaagaagaaagattc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAB42553.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57622.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF78331.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG40469.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative membrane protein
emb|CAI81013.1 Staphylococcus aureus RF122 EMBL   probable membrane protein
fig|158878.1.peg.1460 Staphylococcus aureus subsp. aureus Mu50 FIG   Putative membrane protease YugP
fig|158879.1.peg.1336 Staphylococcus aureus subsp. aureus N315 FIG   Putative membrane protease YugP
fig|158879.11.peg.1392 Staphylococcus aureus subsp. aureus N315 FIG   Putative membrane protease YugP
fig|273036.3.peg.1071 Staphylococcus aureus RF122 FIG   Putative membrane protease YugP
fig|282458.1.peg.1391 Staphylococcus aureus subsp. aureus MRSA252 FIG   Putative membrane protease YugP
fig|282458.4.peg.1475 Staphylococcus aureus subsp. aureus MRSA252 FIG   Putative membrane protease YugP
fig|359786.13.peg.1607 Staphylococcus aureus subsp. aureus JH9 FIG   Putative membrane protease YugP
fig|359786.3.peg.204 Staphylococcus aureus subsp. aureus JH9 FIG   Putative membrane protease YugP
fig|359787.3.peg.1250 Staphylococcus aureus subsp. aureus JH1 FIG   Putative membrane protease YugP
fig|451515.3.peg.1480 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative membrane protease YugP
fig|451516.9.peg.1485 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative membrane protease YugP
fig|546342.3.peg.1327 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Putative membrane protease YugP
fig|546343.3.peg.994 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Putative membrane protease YugP
fig|548470.3.peg.363 Staphylococcus aureus subsp. aureus MN8 FIG   Putative membrane protease YugP
fig|548473.3.peg.1876 Staphylococcus aureus subsp. aureus TCH60 FIG   Putative membrane protease YugP
fig|548474.3.peg.848 Staphylococcus aureus subsp. aureus TCH130 FIG   Putative membrane protease YugP
fig|553565.3.peg.1329 Staphylococcus aureus A5937 FIG   Putative membrane protease YugP
fig|553573.3.peg.2663 Staphylococcus aureus A8115 FIG   Putative membrane protease YugP
fig|553581.3.peg.32 Staphylococcus aureus A9299 FIG   Putative membrane protease YugP
fig|553583.3.peg.23 Staphylococcus aureus A9635 FIG   Putative membrane protease YugP
fig|553588.3.peg.926 Staphylococcus aureus A9719 FIG   Putative membrane protease YugP
fig|553592.3.peg.1603 Staphylococcus aureus A9763 FIG   Putative membrane protease YugP
fig|553594.3.peg.741 Staphylococcus aureus A9765 FIG   Putative membrane protease YugP
fig|553601.3.peg.1516 Staphylococcus aureus A10102 FIG   Putative membrane protease YugP
fig|585143.3.peg.1665 Staphylococcus aureus subsp. aureus 55/2053 FIG   Putative membrane protease YugP
fig|585146.3.peg.1660 Staphylococcus aureus subsp. aureus 68-397 FIG   Putative membrane protease YugP
fig|585150.3.peg.1718 Staphylococcus aureus subsp. aureus C160 FIG   Putative membrane protease YugP
fig|585151.3.peg.1390 Staphylococcus aureus subsp. aureus C427 FIG   Putative membrane protease YugP
fig|585152.3.peg.1445 Staphylococcus aureus subsp. aureus D139 FIG   Putative membrane protease YugP
fig|585155.3.peg.1676 Staphylococcus aureus subsp. aureus H19 FIG   Putative membrane protease YugP
fig|585891.3.peg.1501 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Putative membrane protease YugP
fig|681288.4.peg.1448 Staphylococcus aureus subsp. aureus ED98 FIG   Putative membrane protease YugP
fig|703339.3.peg.1443 Staphylococcus aureus 04-02981 FIG   Putative membrane protease YugP
gb|ABQ49313.1 Staphylococcus aureus subsp. aureus JH9     peptidase, membrane zinc metallopeptidase, putative
gb|ABR52397.1 Staphylococcus aureus subsp. aureus JH1     peptidase membrane zinc metallopeptidase putative
gb|EEW45496.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1908
gb|EEW47479.1 Staphylococcus aureus D30     hypothetical protein SAD30_1262
gi|13701259 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14247231 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147741015 Staphylococcus aureus subsp. aureus JH9 NCBI   peptidase, membrane zinc metallopeptidase, putative
gi|148267946 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1519
gi|149946461 Staphylococcus aureus subsp. aureus JH1 NCBI   peptidase membrane zinc metallopeptidase putative
gi|150394009 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1548
gi|156721914 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979779 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1448
gi|15924450 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1460
gi|15927041 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1293
gi|221138315 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_06673
gi|221140972 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_04958
gi|255006247 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_07260
gi|259160472 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1908
gi|259162916 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1262
gi|49241778 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative membrane protein
gi|49483649 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1471
gi|82656590 Staphylococcus aureus RF122 NCBI   probable membrane protein
gi|82751059 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB1324c
img|637092956 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099970 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637154898 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637816271 Staphylococcus aureus RF122 IMG   probable membrane protein
img|639107870 Staphylococcus aureus aureus JH1 IMG   Protein of unknown function Zn-binding
img|640565866 Staphylococcus aureus aureus JH9 IMG   peptidase, membrane zinc metallopeptidase, putative
img|640779631 Staphylococcus aureus aureus JH1 IMG   peptidase membrane zinc metallopeptidase putative
img|640904192 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641772673 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|sab:SAB1324c Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sah:SaurJH1_1548 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1519 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sar:SAR1471   KEGG   hypothetical protein
kegg|sau:SA1293   KEGG   hypothetical protein
kegg|sav:SAV1460   KEGG   hypothetical protein
kegg|saw:SAHV_1448 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371984.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1460
ref|NP_374574.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1293
ref|YP_001246889.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1519
ref|YP_001316684.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1548
ref|YP_001442038.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1448
ref|YP_040873.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1471
ref|YP_416800.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB1324c
ref|ZP_03563117.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_06673
ref|ZP_03565465.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_04958
ref|ZP_05144848.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_07260
tr|A5ISZ0 Staphylococcus aureus (strain JH9) TrEMBL   Peptidase, membrane zinc metallopeptidase, putative precursor
tr|A6U1S9 Staphylococcus aureus (strain JH1) TrEMBL   Peptidase membrane zinc metallopeptidase putative precursor
tr|A7X2F9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q2YY46 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Probable membrane protein
tr|Q6GGU9 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative membrane protein
tr|Q7A5J9 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1293
tr|Q99U29 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.1489 Glycosyl transferase, group 1 family protein
4 fig|426430.8.peg.1492 Hypothetical transmembrane protein CDS_ID OB1773


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search