The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1423: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
Translate Function Assignments



Context on contig NC_009641 from base 1434322 to 1446551 (12230 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1418 1434322 1435923 1602 +       1: 12   ABC transporter ATP-binding protein uup locus|NWMN_1303, protein_id|YP_001332337.1, gi|151221515, geneID|5330773
1419 1436783 1437988 1206 + 859     5: 4 6 5 2 1   Aspartokinase (EC 2.7.2.4) gene_name|lysC, locus|NWMN_1304, protein_id|YP_001332338.1, gi|151221516, geneID|5330774
1420 1438052 1439041 990 + 63     5: 4 6 5 2 1   Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) gene_name|asd, locus|NWMN_1305, protein_id|YP_001332339.1, gi|151221517, geneID|5332108
1421 1439043 1439930 888 + 1     6: 3 2 1 14 7 8   4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) gene_name|dapA, locus|NWMN_1306, protein_id|YP_001332340.1, gi|151221518, geneID|5331759
1422 1439927 1440649 723 + -4     3: 3 2 1   4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) gene_name|dapB, locus|NWMN_1307, protein_id|YP_001332341.1, gi|151221519, geneID|5331853
1423 1440676 1441395 720 + 26     3: 2 1 13   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89) gene_name|dapD, locus|NWMN_1308, protein_id|YP_001332342.1, gi|151221520, geneID|5331854
1424 1441538 1442689 1152 + 142     2: 2 1   N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47) gene_name|hipO, locus|NWMN_1309, protein_id|YP_001332343.1, gi|151221521, geneID|5331855
1425 1442694 1443779 1086 + 4     2: 2 1   Diaminopimelate epimerase alternative form predicted for S.aureus (EC 5.1.1.7) gene_name|alr2, locus|NWMN_1310, protein_id|YP_001332344.1, gi|151221522, geneID|5331997
1426 1443769 1445034 1266 + -11     5: 3 2 1 11 10   Diaminopimelate decarboxylase (EC 4.1.1.20) gene_name|lysA, locus|NWMN_1311, protein_id|YP_001332345.1, gi|151221523, geneID|5331732
1427 1445675 1445274 402 - 239         Protein msa (Modulator of sarA) locus|NWMN_1312, protein_id|YP_001332346.1, gi|151221524, geneID|5332107
1428 1446072 1445872 201 - 196     1: 9 dlit(16291691) Cold shock protein of CSP family => CspA (naming convention as in S.aureus) gene_name|cspA, locus|NWMN_1313, protein_id|YP_001332347.1, gi|151221525, geneID|5330775
1429 1446551 1446243 309 - 170         FIG01108332: hypothetical protein locus|NWMN_1314, protein_id|YP_001332348.1, gi|151221526, geneID|5331840

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Lysine_Biosynthesis_DAP_Pathway AndreiO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
Lysine_biosynthesis_PanGenomes Acharya_Geeta_user 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)


  Protein Sequence

>fig|426430.8.peg.1423 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPCKVIKAASEVQDTKKEIVAALRKLND

MD5 = 36c9f91a6ade1612300a7f9e27530573


  DNA Sequence

>fig|426430.8.peg.1423 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
atggtacaacatttaacagctgaagaaattattcaatatataagtgatgctaaaaagtct
acaccaataaaagtatatttaaatggtaattttgaaggcatcacatatccagaaagtttt
aaagtatttggttcagaacaatctaaagtaatcttttgtgaagcggatgattggaaacct
ttttacgaagcatatggtagtcaattcgaagatatagaaattgaaatggatcgtcgcaat
tctgctattccattaaaagacttaacaaatacgaatgcacgaattgaaccaggtgcgttt
attagagaacaagccattattgaagatggtgctgtcgttatgatgggcgcaacaattaat
attggcgcagtcgttggcgaaggtacaatgattgatatgaatgctactctcggtggtcgt
gctacaactggtaaaaatgtacatgtaggggctggcgcagtattagcaggtgtgattgaa
ccccctagtgcttcaccggttataatcgaggatgatgtattaatcggtgcaaatgcagtt
attttagaaggtgtacgtgttggtaaaggtgctattgttgcagctggcgcgattgtgaca
caagatgtaccagctggtgcagttgttgctggtacaccctgcaaagtgattaaagcagct
tctgaagtacaagatactaaaaaagagattgtagcagcattaagaaaactgaatgactag


  DNA with Flanking Sequence

>fig|426430.8.peg.1423 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
aaagaaaaactacttaataagttagatgaattgagtcaaaatatgcctgtgtttttcagc
gcgaacatgagttatggcgttcatgcattgactaaaattttagcagctgctgttccccta
cttgatgatttcgacatcgaattgactgaggcacatcataataaaaaagtagatgcacca
agtggtacgttagaaaaattgtatgatgtgatcgtatctttgaaagaaaatgtaacacct
gtgtatgatagacatgaattaaatgaaaaacgccagccacaagatattggtatacattct
attcgtggaggtacgattgtcggtgaacatgaagttctatttgctggcactgatgaaacg
attcaaatcacgcatcgtgcacaatcaaaagatatttttgcgaatggtgcaatacaagca
gcagaacgcttagttaataaaccaaacggcttttatacgtttgacaacttataaacatat
taaaggagatcgattattttatggtacaacatttaacagctgaagaaattattcaatata
taagtgatgctaaaaagtctacaccaataaaagtatatttaaatggtaattttgaaggca
tcacatatccagaaagttttaaagtatttggttcagaacaatctaaagtaatcttttgtg
aagcggatgattggaaacctttttacgaagcatatggtagtcaattcgaagatatagaaa
ttgaaatggatcgtcgcaattctgctattccattaaaagacttaacaaatacgaatgcac
gaattgaaccaggtgcgtttattagagaacaagccattattgaagatggtgctgtcgtta
tgatgggcgcaacaattaatattggcgcagtcgttggcgaaggtacaatgattgatatga
atgctactctcggtggtcgtgctacaactggtaaaaatgtacatgtaggggctggcgcag
tattagcaggtgtgattgaaccccctagtgcttcaccggttataatcgaggatgatgtat
taatcggtgcaaatgcagttattttagaaggtgtacgtgttggtaaaggtgctattgttg
cagctggcgcgattgtgacacaagatgtaccagctggtgcagttgttgctggtacaccct
gcaaagtgattaaagcagcttctgaagtacaagatactaaaaaagagattgtagcagcat
taagaaaactgaatgactagtgacgtcaacgtataataatttcaaggttgagatacgatt
atgtctcaaccttattgtttagcattgaataaacttatgatcacaaatttcgaaatacgt
tacactatttatatagtaatttaacacaaaggattgataattatgaatgaattagaattt
gttacgaaacatcgccgtcatttacatcaacatcctgaattaagcttacatgaatttgaa
acaactgcttatattaaagcgtttttagatagtttaaatattaaatacgattgcccattg
gaaactggcgtcattgcatacttagaaggtaatggctcacatacgatagcgtatagagct
gatattgatgcgttacctattttagaggaaaatgatgtgccttatcgcagtcaatctgat
catgtgatgcatgcttgtggacatgatggtcatacaactgcattaatgctttttgtacaa
cgttgcaaagacatgcaagatgcaggtcaattaccgcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0047200       F:tetrahydrodipicolinate N-acetyltransferase ...
dbj|BAF67580.1 Staphylococcus aureus subsp. aureus str. Newman     tetrahydrodipicolinate acetyltransferase
fig|426430.6.peg.1269 Staphylococcus aureus subsp. aureus str. Newman FIG   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89)
gi|150374320 Staphylococcus aureus subsp. aureus str. Newman NCBI   tetrahydrodipicolinate acetyltransferase
gi|151221520 Staphylococcus aureus subsp. aureus str. Newman NCBI   tetrahydrodipicolinate acetyltransferase
gi|238064892 organism not parsed/found in ncbi nr NCBI   RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; AltName: Full=Tetrahydrodipicolinate N-acetyltransferase; Short=THP acetyltransferase; Short=Tetrahydropicolinate acetylase
img|640795689 Staphylococcus aureus aureus Newman IMG   tetrahydrodipicolinate acetyltransferase
kegg|sae:NWMN_1308 Staphylococcus aureus subsp. aureus Newman KEGG   tetrahydrodipicolinate acetyltransferase
ref|YP_001332342.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   tetrahydrodipicolinate acetyltransferase
sp|A6QGU8 Staphylococcus aureus (strain Newman) SwissProt   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
sp|DAPH_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; AltName: Full=Tetrahydrodipicolinate N-acetyltransferase; Short=THP acetyltransferase; Short=Tetrahydropicolinate acetylase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search