The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1252: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Signal recognition particle associated protein
Translate Function Assignments



Context on contig NC_009641 from base 1251851 to 1264698 (12848 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1249 1251851 1252582 732 +   6 4: 1 6 2 11 dlit(15678100) Ribonuclease III (EC 3.1.26.3) gene_name|rnc, locus|NWMN_1143, protein_id|YP_001332177.1, gi|151221355, geneID|5331712
1250 1252729 1256295 3567 + 146 18 2: 1 2   Chromosome partition protein smc gene_name|smc, locus|NWMN_1144, protein_id|YP_001332178.1, gi|151221356, geneID|5332360
1251 1256295 1257545 1251 + -1 22 4: 3 1 10 9   Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1) gene_name|ftsY, locus|NWMN_1145, protein_id|YP_001332179.1, gi|151221357, geneID|5332490
1252 1257532 1257864 333 + -14   1: 1   Signal recognition particle associated protein locus|NWMN_1146, protein_id|YP_001332180.1, gi|151221358, geneID|5331933
1253 1257890 1259257 1368 + 25 33 2: 3 1   Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1) gene_name|ffh, locus|NWMN_1147, protein_id|YP_001332181.1, gi|151221359, geneID|5330697
1254 1259692 1259967 276 + 434 25 2: 4 7   SSU ribosomal protein S16p gene_name|rpsP, locus|NWMN_1148, protein_id|YP_001332182.1, gi|151221360, geneID|5331906
1255 1260155 1260658 504 + 187 19 1: 5   16S rRNA processing protein RimM gene_name|rimM, locus|NWMN_1149, protein_id|YP_001332183.1, gi|151221361, geneID|5332420
1256 1260658 1261395 738 + -1 17 3: 8 15 5   tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31) gene_name|trmD, locus|NWMN_1150, protein_id|YP_001332184.1, gi|151221362, geneID|5332357
1257 1261498 1261848 351 + 102 11 4: 4 14 12 13   LSU ribosomal protein L19p gene_name|rplS, locus|NWMN_1151, protein_id|YP_001332185.1, gi|151221363, geneID|5332558
1258 1264698 1262092 2607 - 243         FIG01108412: hypothetical protein locus|NWMN_1152, protein_id|YP_001332186.1, gi|151221364, geneID|5332382

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Two_cell_division_clusters_relating_to_chromosome_partitioning RossO Signal recognition particle associated protein


  Protein Sequence

>fig|426430.8.peg.1252 Signal recognition particle associated protein
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE

MD5 = 9068720a5ef9bd23afc36258b1786960


  DNA Sequence

>fig|426430.8.peg.1252 Signal recognition particle associated protein
atgggtcaaaatgatttagttaaaacgttacgaatgaattatttgtttgatttttatcaa
tccttattgacgaataaacaacgtaattatttggaattattttatcttgaagattattct
ttaagtgaaatcgcagatacttttaatgtgagtagacaagcagtttatgataatataaga
agaactggcgatttagttgaagattatgaaaagaaattggaattataccagaaatttgag
caacgccgagaaatatatgatgaaatgaaacaacatttaagtaatccagaacaaatacaa
cgttatattcaacaattagaagacttagaatag


  DNA with Flanking Sequence

>fig|426430.8.peg.1252 Signal recognition particle associated protein
ccaaagtgaaggttctgatccagctgctgttatgtatgatgcgattaatgccgctaaaaa
caaaggtgttgatattttaatctgtgataccgctggacgtttacaaaataaaacaaatct
aatgcaagaattagaaaaagttaagcgtgtaattaatcgagcagtgccagatgcgcctca
tgaagcattactatgtttagatgctacaactggtcagaatgcgttgtcacaagctagaaa
ctttaaagaagtaacaaatgttacaggtattgtattaacgaaattagatggtacagccaa
aggtggtatcgtattagccattcgtaatgaattgcacatcccagttaaatatgtaggttt
aggtgagcaattagatgacttacaaccatttaaccctgaaagttatgtctacggcttatt
cgctgatatgattgaacaaaatgaagaaataacaacagttgaaaatgatcaaattgtaac
agaagaaaaggacgataatcatgggtcaaaatgatttagttaaaacgttacgaatgaatt
atttgtttgatttttatcaatccttattgacgaataaacaacgtaattatttggaattat
tttatcttgaagattattctttaagtgaaatcgcagatacttttaatgtgagtagacaag
cagtttatgataatataagaagaactggcgatttagttgaagattatgaaaagaaattgg
aattataccagaaatttgagcaacgccgagaaatatatgatgaaatgaaacaacatttaa
gtaatccagaacaaatacaacgttatattcaacaattagaagacttagaatagatataaa
ttgagggaggacatcgatatggcatttgaagggttatcagaacgcttgcaagcgacgatg
caaaaaatgcgtggtaagggtaaacttactgaagctgatataaagataatgatgcgtgaa
gtaagattagcgttacttgaggctgacgtaaactttaaagtggtaaaagaatttattaaa
acagtatcagaacgcgcattaggttccgatgtaatgcaatcattaacaccagggcaacaa
gttattaaaatagttcaagatgaattaacgcagttgatgggtggagaaaatacgtcgatt
aatatgtcaaataaaccacctactgttgttatgatggttggtttacaaggtgctggtaaa
acaacaactgcaggtaaattagcattattgatgcgtaaaaaatacaacaaaaaacctatg
ttagttgcagcagatatttatcgtccagcagcgataaatcaattacaaacagtagggaaa
caaattgatattc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0006352       P:transcription initiation
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0016987       F:sigma factor activity
cmr|NT01SA1175 Staphylococcus aureus N315     Unknown
cmr|NT02SA1223 Staphylococcus aureus Mu50     TcsBorf1
cmr|NT03SA1218 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA1084 Staphylococcus aureus NCTC 8325     protein //
cmr|NT09SA1161 Staphylococcus aureus subsp. aureus MSSA476     gene regulatory 13K protein
cmr|NT11SA1114 Staphylococcus aureus RF122     YlxM
cmr|SACOL1252 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1129 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB42331.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57398.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94984.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67418.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF78109.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG42947.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative DNA-binding protein
emb|CAI80789.1 Staphylococcus aureus RF122 EMBL   conserved hypothetical protein
fig|158878.1.peg.1236 Staphylococcus aureus subsp. aureus Mu50 FIG   Signal recognition particle associated protein
fig|158878.14.peg.1270 Staphylococcus aureus subsp. aureus Mu50 FIG   Signal recognition particle associated protein
fig|158879.1.peg.1114 Staphylococcus aureus subsp. aureus N315 FIG   Signal recognition particle associated protein
fig|158879.11.peg.1158 Staphylococcus aureus subsp. aureus N315 FIG   Signal recognition particle associated protein
fig|196620.1.peg.1119 Staphylococcus aureus subsp. aureus MW2 FIG   Signal recognition particle associated protein
fig|196620.5.peg.1174 Staphylococcus aureus subsp. aureus MW2 FIG   Signal recognition particle associated protein
fig|273036.3.peg.1380 Staphylococcus aureus RF122 FIG   Signal recognition particle associated protein
fig|273036.6.peg.1168 Staphylococcus aureus RF122 FIG   Signal recognition particle associated protein
fig|282459.1.peg.1163 Staphylococcus aureus subsp. aureus MSSA476 FIG   Signal recognition particle associated protein
fig|282459.5.peg.1216 Staphylococcus aureus subsp. aureus MSSA476 FIG   Signal recognition particle associated protein
fig|359786.13.peg.1375 Staphylococcus aureus subsp. aureus JH9 FIG   Signal recognition particle associated protein
fig|359786.3.peg.958 Staphylococcus aureus subsp. aureus JH9 FIG   Signal recognition particle associated protein
fig|359787.3.peg.216 Staphylococcus aureus subsp. aureus JH1 FIG   Signal recognition particle associated protein
fig|367830.3.peg.469 Staphylococcus aureus subsp. aureus USA300 FIG   Signal recognition particle associated protein
fig|418127.4.peg.1132 Staphylococcus aureus subsp. aureus Mu3 FIG   Signal recognition particle associated protein
fig|426430.6.peg.1111 Staphylococcus aureus subsp. aureus str. Newman FIG   Signal recognition particle associated protein
fig|450394.6.peg.468 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Signal recognition particle associated protein
fig|451515.3.peg.1240 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Signal recognition particle associated protein
fig|451516.9.peg.1244 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Signal recognition particle associated protein
fig|452948.4.peg.900 Staphylococcus aureus 930918-3 FIG   Signal recognition particle associated protein
fig|455227.3.peg.121 Staphylococcus aureus D30 FIG   Signal recognition particle associated protein
fig|505321.3.peg.1094 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Signal recognition particle associated protein
fig|546342.3.peg.1184 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Signal recognition particle associated protein
fig|546343.3.peg.2082 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Signal recognition particle associated protein
fig|548474.3.peg.1076 Staphylococcus aureus subsp. aureus TCH130 FIG   Signal recognition particle associated protein
fig|548475.3.peg.150 Staphylococcus aureus subsp. aureus TCH70 FIG   Signal recognition particle associated protein
fig|553565.3.peg.1563 Staphylococcus aureus A5937 FIG   Signal recognition particle associated protein
fig|553567.3.peg.2042 Staphylococcus aureus A5948 FIG   Signal recognition particle associated protein
fig|553568.3.peg.1757 Staphylococcus aureus A6224 FIG   Signal recognition particle associated protein
fig|553571.3.peg.2645 Staphylococcus aureus A6300 FIG   Signal recognition particle associated protein
fig|553573.3.peg.2433 Staphylococcus aureus A8115 FIG   Signal recognition particle associated protein
fig|553577.3.peg.1999 Staphylococcus aureus A8796 FIG   Signal recognition particle associated protein
fig|553580.3.peg.2314 Staphylococcus aureus A8819 FIG   Signal recognition particle associated protein
fig|553581.3.peg.962 Staphylococcus aureus A9299 FIG   Signal recognition particle associated protein
fig|553588.3.peg.10 Staphylococcus aureus A9719 FIG   Signal recognition particle associated protein
fig|553590.4.peg.287 Staphylococcus aureus A9754 FIG   Signal recognition particle associated protein
fig|553592.3.peg.2261 Staphylococcus aureus A9763 FIG   Signal recognition particle associated protein
fig|553594.3.peg.152 Staphylococcus aureus A9765 FIG   Signal recognition particle associated protein
fig|553601.3.peg.1158 Staphylococcus aureus A10102 FIG   Signal recognition particle associated protein
fig|585152.3.peg.1088 Staphylococcus aureus subsp. aureus D139 FIG   Signal recognition particle associated protein
fig|585155.3.peg.1416 Staphylococcus aureus subsp. aureus H19 FIG   Signal recognition particle associated protein
fig|585891.3.peg.1267 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Signal recognition particle associated protein
fig|644279.4.peg.1250 Staphylococcus aureus subsp. aureus 132 FIG   Signal recognition particle associated protein
fig|680649.3.peg.112 Staphylococcus aureus subsp. aureus MR1 FIG   Signal recognition particle associated protein
fig|681288.4.peg.1213 Staphylococcus aureus subsp. aureus ED98 FIG   Signal recognition particle associated protein
fig|703339.3.peg.1211 Staphylococcus aureus 04-02981 FIG   Signal recognition particle associated protein
fig|762962.3.peg.822 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Signal recognition particle associated protein
fig|93061.3.peg.1153 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Signal recognition particle associated protein
fig|93061.5.peg.1106 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Signal recognition particle associated protein
fig|93062.4.peg.1676 Staphylococcus aureus subsp. aureus COL FIG   Signal recognition particle associated protein
gb|AAW38085.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21155.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30311.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ49094.1 Staphylococcus aureus subsp. aureus JH9     putative helix-turn-helix protein, YlxM/p13 family protein
gb|ABR52173.1 Staphylococcus aureus subsp. aureus JH1     putative helix-turn-helix protein YlxM/p13 family protein
gb|EES55058.1 Staphylococcus aureus subsp. aureus TCH70     transcriptional regulator
gb|EES93135.1 Staphylococcus aureus subsp. aureus USA300_TCH959     transcriptional regulator
gb|EES97309.1 Staphylococcus aureus subsp. aureus TCH130     transcriptional regulator
gb|EEV28020.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63742.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV68646.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73193.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74020.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76743.1 Staphylococcus aureus A6300     hypothetical protein SAIG_00248
gb|EEV80321.1 Staphylococcus aureus A6224     UPF0122 protein
gb|EEV82594.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV85961.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45294.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1415
gb|EEW48255.1 Staphylococcus aureus D30     hypothetical protein SAD30_1910
gi|122539707 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAOUHSC_01206
gi|123486212 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAUSA300_1129
gi|123549047 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAB1100
gi|13701036 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14247006 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740796 Staphylococcus aureus subsp. aureus JH9 NCBI   putative helix-turn-helix protein, YlxM/p13 family protein
gi|148267727 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1295
gi|149946237 Staphylococcus aureus subsp. aureus JH1 NCBI   putative helix-turn-helix protein YlxM/p13 family protein
gi|150374158 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393785 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1320
gi|151221358 Staphylococcus aureus subsp. aureus str. Newman NCBI   putative DNA-binding protein
gi|156721692 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979557 Staphylococcus aureus subsp. aureus Mu3 NCBI   putative DNA-binding protein
gi|15924226 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1236
gi|15926819 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1079
gi|166228921 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAHV_1226
gi|189038653 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SaurJH9_1295
gi|189038658 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SaurJH1_1320
gi|205405729 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein NWMN_1146
gi|21204287 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282848 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1119
gi|221138178 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05938
gi|221142026 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_10395
gi|251802401 Staphylococcus aureus subsp. aureus TCH70 NCBI   transcriptional regulator
gi|251814145 Staphylococcus aureus subsp. aureus TCH70 NCBI   transcriptional regulator
gi|253315594 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative DNA-binding protein
gi|253724406 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   transcriptional regulator
gi|253728580 Staphylococcus aureus subsp. aureus TCH130 NCBI   transcriptional regulator
gi|253731854 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   transcriptional regulator
gi|253733526 Staphylococcus aureus subsp. aureus TCH130 NCBI   transcriptional regulator
gi|255006023 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   putative DNA-binding protein
gi|257789680 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795708 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839268 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257844264 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849211 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850067 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257853784 Staphylococcus aureus A6300 NCBI   hypothetical protein SAIG_00248
gi|257857423 Staphylococcus aureus A6224 NCBI   UPF0122 protein
gi|257859752 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257863197 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258415932 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258419679 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258434850 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444574 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447593 Staphylococcus aureus A6300 NCBI   hypothetical protein SAIG_00248
gi|258449435 Staphylococcus aureus A6224 NCBI   UPF0122 protein
gi|258452534 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454814 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259160266 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1415
gi|259163700 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1910
gi|49244518 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative DNA-binding protein
gi|49486075 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1170
gi|54040015 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SA1079
gi|54040042 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein MW1119
gi|54042679 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAV1236
gi|56749718 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SAS1170
gi|57285991 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651805 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1252
gi|71153430 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0122 protein SACOL1252
gi|82656371 Staphylococcus aureus RF122 NCBI   conserved hypothetical protein
gi|82750840 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB1100
gi|87126641 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160667 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative DNA-binding protein
gi|87202501 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194943 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01206
img|637092734 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099748 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637152011 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157400 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298883 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637816052 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637887781 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893837 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109940 Staphylococcus aureus aureus JH1 IMG   Putative helix-turn-helix protein, YlxM/p13-like
img|640565646 Staphylococcus aureus aureus JH9 IMG   putative helix-turn-helix protein, YlxM/p13 family protein
img|640779407 Staphylococcus aureus aureus JH1 IMG   putative helix-turn-helix protein YlxM/p13 family protein
img|640795527 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903970 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641771397 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1129 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative DNA-binding protein
kegg|sab:SAB1100 Staphylococcus aureus RF122 KEGG   putative DNA-binding protein
kegg|sac:SACOL1252 Staphylococcus aureus subsp. aureus COL KEGG   putative DNA-binding protein
kegg|sae:NWMN_1146 Staphylococcus aureus subsp. aureus Newman KEGG   putative DNA-binding protein
kegg|sah:SaurJH1_1320 Staphylococcus aureus subsp. aureus JH1 KEGG   putative DNA-binding protein
kegg|saj:SaurJH9_1295 Staphylococcus aureus subsp. aureus JH9 KEGG   putative DNA-binding protein
kegg|sam:MW1119 Staphylococcus aureus subsp. aureus MW2 KEGG   putative DNA-binding protein
kegg|sao:SAOUHSC_01206 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1170   KEGG   putative DNA-binding protein
kegg|sau:SA1079   KEGG   putative DNA-binding protein
kegg|sav:SAV1236   KEGG   putative DNA-binding protein
kegg|saw:SAHV_1226 Staphylococcus aureus subsp. aureus Mu3 KEGG   putative DNA-binding protein
ref|NP_371760.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1236
ref|NP_374352.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1079
ref|NP_645936.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1119
ref|YP_001246670.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1295
ref|YP_001316460.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1320
ref|YP_001332180.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   putative DNA-binding protein
ref|YP_001441816.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   putative DNA-binding protein
ref|YP_043296.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1170
ref|YP_186111.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1252
ref|YP_416581.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB1100
ref|YP_493826.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative DNA-binding protein
ref|YP_499743.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01206
ref|ZP_03562980.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05938
ref|ZP_03566519.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_10395
ref|ZP_04828618.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   transcriptional regulator
ref|ZP_04838807.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative DNA-binding protein
ref|ZP_04866019.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   transcriptional regulator
ref|ZP_04867691.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   transcriptional regulator
ref|ZP_05144624.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   putative DNA-binding protein
ref|ZP_05644687.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682202.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05682646.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688924.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692903.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695737.1 Staphylococcus aureus A6300 RefSeq   hypothetical protein SAIG_00248
ref|ZP_05697538.1 Staphylococcus aureus A6224 RefSeq   UPF0122 protein
ref|ZP_05700540.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05702778.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
sp|A5ISC1 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=UPF0122 protein SaurJH9_1295
sp|A6QGD6 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=UPF0122 protein NWMN_1146
sp|A6U155 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=UPF0122 protein SaurJH1_1320
sp|A7X1K4 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=UPF0122 protein SAHV_1226
sp|P67248 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=UPF0122 protein SAV1236
sp|P67249 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=UPF0122 protein SA1079
sp|P67250 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=UPF0122 protein MW1119
sp|Q2FHK2 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=UPF0122 protein SAUSA300_1129
sp|Q2FZ47 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=UPF0122 protein SAOUHSC_01206
sp|Q2YXI0 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   RecName: Full=UPF0122 protein SAB1100
sp|Q5HGJ6 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0122 protein SACOL1252
sp|Q6G9X7 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=UPF0122 protein SAS1170
sp|Y1079_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SA1079
sp|Y1100_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAB1100
sp|Y1119_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein MW1119
sp|Y1129_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAUSA300_1129
sp|Y1146_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein NWMN_1146
sp|Y1170_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAS1170
sp|Y1206_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAOUHSC_01206
sp|Y1226_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAHV_1226
sp|Y1236_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SAV1236
sp|Y1252_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SACOL1252
sp|Y1295_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SaurJH9_1295
sp|Y1320_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0122 protein SaurJH1_1320
tr|C5N4X7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Transcriptional regulator
tr|C5Q0M2 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Transcriptional regulator
tr|C5QIK2 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Transcriptional regulator


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|426430.8.peg.1249 Ribonuclease III (EC 3.1.26.3)
18 fig|426430.8.peg.1250 Chromosome partition protein smc
22 fig|426430.8.peg.1251 Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)
33 fig|426430.8.peg.1253 Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)
25 fig|426430.8.peg.1254 SSU ribosomal protein S16p
19 fig|426430.8.peg.1255 16S rRNA processing protein RimM
17 fig|426430.8.peg.1256 tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)
11 fig|426430.8.peg.1257 LSU ribosomal protein L19p


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search